LXL04_027412 | RubberDandelionOmics

Gene overview

LXL04_027412

Reference: OH-1004 Chr: Chr06 Coordinates: 15137564-15139095 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

490 bp · LXL04_027412|LXL04_027412|OH1004|cDNA

ATTTTTCAATCATTCAAATATTTGAGGCGATTTCTATTTTCCTCCTTTCGAGAAATTTTGCAGAAGCTCTTCAGACATCGCGAGAATCAAGCAGCATTTCATACAACTTGCACCTGAAGATTCACAGGAGAGATCACTCATAATGGGCTGTGTTAAATCTTCGAACAACGATAATGGCAGACGTGTAAGACGTAACAGAATCAGTAGACCGGCGCCTTGGGCCCACACTGAGCCCATAACTCGTGCTCAACTCAATGCAA...

CDS

Download CDS FASTA

348 bp · LXL04_027412|LXL04_027412|OH1004|CDS

ATGGGCTGTGTTAAATCTTCGAACAACGATAATGGCAGACGTGTAAGACGTAACAGAATCAGTAGACCGGCGCCTTGGGCCCACACTGAGCCCATAACTCGTGCTCAACTCAATGCAATGCGTGCCGAATTTTGGAACGGAATTCCACAGTATGGCGGCCAGCGAGAGGTTTGGGAAGCACTTAGAGCAGCCGTGGATGCCGAGTTACACTTGGCACACACAATAATTGATAATGCGGGAATTATCCTTCACGCGCACGA...

Protein

Download Protein FASTA

115 aa · LXL04_027412|LXL04_027412|OH1004|PROTEIN

MGCVKSSNNDNGRRVRRNRISRPAPWAHTEPITRAQLNAMRAEFWNGIPQYGGQREVWEALRAAVDAELHLAHTIIDNAGIILHAHDLTVSFDENGARYDLPLYVLSEPTNLING

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027412`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_027412`
Location	Chr06:15137564-15139095 (-)
Description	Similar to ubtd1: Ubiquitin domain-containing protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_027412` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference	dre:436991 mmu:327900 xla:447780 xtr:448143 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.456

Rank 1 · LXL04_027412 · OH-1004

Cell membrane0.405

Rank 2 · LXL04_027412 · OH-1004

Nucleus0.256

Rank 3 · LXL04_027412 · OH-1004

Golgi apparatus0.071

Rank 4 · LXL04_027412 · OH-1004

Endoplasmic reticulum0.058

Rank 5 · LXL04_027412 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16455.11UBD18-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027412	`PF16455.11`	UBD	18	114	6.8e-29	100.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card