LXL04_027343 | RubberDandelionOmics

Gene overview

LXL04_027343

Reference: OH-1004 Chr: Chr06 Coordinates: 14000012-14002744 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2733 bp · LXL04_027343|LXL04_027343|OH1004|cDNA

atgcaggaactttctagccaactccaggagctgttgagcaaaggatttatcagaccgagcttctcaccctggggagcgccggtattatttgtgaaaaagaaagacggttcctttcgaatgtgcatagattatagagaactgaacaagctgaccattaagaataggtaccctctcccgaggattgatgatctatttgaccagttgctagggtcaacccacttttcaaaaatagacctaagatccgggtaccaccagctgag...

CDS

Download CDS FASTA

2733 bp · LXL04_027343|LXL04_027343|OH1004|CDS

ATGCAGGAACTTTCTAGCCAACTCCAGGAGCTGTTGAGCAAAGGATTTATCAGACCGAGCTTCTCACCCTGGGGAGCGCCGGTATTATTTGTGAAAAAGAAAGACGGTTCCTTTCGAATGTGCATAGATTATAGAGAACTGAACAAGCTGACCATTAAGAATAGGTACCCTCTCCCGAGGATTGATGATCTATTTGACCAGTTGCTAGGGTCAACCCACTTTTCAAAAATAGACCTAAGATCCGGGTACCACCAGCTGAG...

Protein

Download Protein FASTA

910 aa · LXL04_027343|LXL04_027343|OH1004|PROTEIN

MQELSSQLQELLSKGFIRPSFSPWGAPVLFVKKKDGSFRMCIDYRELNKLTIKNRYPLPRIDDLFDQLLGSTHFSKIDLRSGYHQLSVQEEDIPKTAFRTRYGHYEFLVMPFGLTNAPAVFMDLMNRVCRPYLDKFVIVFIDDILIYSRSEAEHGRHLRLILELLRKEKLYAKFSKCEFWLREVKFLGHVVSRDGIHVDPSKIEAIKDWKAPKTPTEIRQFLGLAGYYRRFIANFSKLAKLLTALTQKGVAFDWEDKQEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027343`
TK1151 ID	TkA07G431820
OH-1004 ID	LXL04_027343
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.500
Protein coverage (%)	TK1151 64.912 / OH-1004 20.330 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_027343`
Location	Chr06:14000012-14002744 (+)
Description	Similar to TY3B-I: Transposon Ty3-I Gag-Pol polyprotein (Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_027343` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006310 DNA recombination Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0075523 viral translational frameshifting Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0003677 DNA binding Molecular Function GO:0003723 RNA binding Molecular Function GO:0003887 DNA-directed DNA polymerase activity Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004190 aspartic-type endopeptidase activity Molecular Function GO:0004519 endonuclease activity Molecular Function
KEGG gene cross-reference	sce:YGR109W-B sce:YIL082W-A spo:2538755 spo:2541833 spo:2541991 spo:3361422 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.522

Rank 1 · LXL04_027343 · OH-1004

Nucleus0.373

Rank 2 · LXL04_027343 · OH-1004

Mitochondrion0.152

Rank 3 · LXL04_027343 · OH-1004

Cell membrane0.037

Rank 4 · LXL04_027343 · OH-1004

Endoplasmic reticulum0.025

Rank 5 · LXL04_027343 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00078.33RVT_131-190 aa

PF17919.8RT_RNaseH_2254-348 aa

PF17917.8RT_RNaseH282-378 aa

PF17921.8Integrase_H2C2470-523 aa

PF00665.33rve544-638 aa

PF29688.1TnsB_C591-656 aa

PF31073.1DUF8803762-829 aa

PF24626.2SH3_Tf2-1765-829 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027343	`PF00078.33`	RVT_1	31	190	6.3e-40	137.9
LXL04_027343	`PF17919.8`	RT_RNaseH_2	254	348	3.3e-30	104.8
LXL04_027343	`PF17917.8`	RT_RNaseH	282	378	7.1e-34	116.8
LXL04_027343	`PF17921.8`	Integrase_H2C2	470	523	4.3e-17	62.7
LXL04_027343	`PF00665.33`	rve	544	638	2.4e-08	34.9
LXL04_027343	`PF29688.1`	TnsB_C	591	656	1e-05	26.0
LXL04_027343	`PF31073.1`	DUF8803	762	829	8.8e-08	32.6
LXL04_027343	`PF24626.2`	SH3_Tf2-1	765	829	6.3e-28	97.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card