LXL04_027246 | RubberDandelionOmics

Gene overview

LXL04_027246

Reference: OH-1004 Chr: Chr06 Coordinates: 11651630-11657320 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5313 bp · LXL04_027246|LXL04_027246|OH1004|cDNA

ATGAACTTGAGGCAAAGACCAGTACCTACGCGTGGACGGGAATATCCCGACGCGCTGCCACTTGCGGCTAGGTATGAGGAGCCGTATAATATAATCCCGATACACAGTTTACTCTCTGATCACCCGTCTCTTCGGTACCCGGAAGTGAGAGCGGCGGCTGCTGCTCTCCGCGCTGTCGGAGACCTCCGGCGGCCGCCGTTTAGAGAATGGCGAGATGGGATGGACCTTATGGATTGGCTCGGTGCTTTTTTTGGGTTTCA...

CDS

Download CDS FASTA

5313 bp · LXL04_027246|LXL04_027246|OH1004|CDS

ATGAACTTGAGGCAAAGACCAGTACCTACGCGTGGACGGGAATATCCCGACGCGCTGCCACTTGCGGCTAGGTATGAGGAGCCGTATAATATAATCCCGATACACAGTTTACTCTCTGATCACCCGTCTCTTCGGTACCCGGAAGTGAGAGCGGCGGCTGCTGCTCTCCGCGCTGTCGGAGACCTCCGGCGGCCGCCGTTTAGAGAATGGCGAGATGGGATGGACCTTATGGATTGGCTCGGTGCTTTTTTTGGGTTTCA...

Protein

Download Protein FASTA

1770 aa · LXL04_027246|LXL04_027246|OH1004|PROTEIN

MNLRQRPVPTRGREYPDALPLAARYEEPYNIIPIHSLLSDHPSLRYPEVRAAAAALRAVGDLRRPPFREWRDGMDLMDWLGAFFGFQNDNVRNQREHLVLHLANAQMRLSPPPAIADNLDPGVLREFRRKLLKNYKSWCSFLRQKSQVRLPSFRQNHDTHRRELLYVAMYLLIWGEAANLRFTPECICYIYHHMTMELNQVLSGDTDANTGRPFNPTISGENAFLNKIITPIYITIKTEVDRSRNGTAPHSAWRNYDDIN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027246`
TK1151 ID	TkA07G041310
OH-1004 ID	LXL04_027246
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 98.218 / OH-1004 56.045 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027246

Location Chr06:11651630-11657320 (+)

Description Similar to CALS11: Callose synthase 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g04970`	Required the formation of the callose wall separating the tetraspores (interstitial wall), but not for the callose wall surrounding the pollen mother cells (peripheral wall).	Two callose synthases, GSL1 and GSL5, play an essential and redundant role in plant and pollen development and in fertility.2005 · DOI: 10.1007/s11103-005-4526-7
`At4g03550`	Involved in sporophytic and gametophytic development.	An Arabidopsis callose synthase.2002 · DOI: 10.1023/a:1015558231400 An Arabidopsis Callose Synthase, GSL5, Is Required for Wound and Papillary Callose Formation.2003 · DOI: 10.1105/tpc.016097 Two callose synthases, GSL1 and GSL5, play an essential and redundant role in plant and pollen development and in fertility.2005 · DOI: 10.1007/s11103-005-4526-7
`At2g13680`	Required for the formation of the callose wall separating the tetraspores (interstitial wall) and surrounding the pollen mother cells (peripheral wall).	Callose synthase (CalS5) is required for exine formation during microgametogenesis and for pollen viability in Arabidopsis.2005 · DOI: 10.1111/j.1365-313x.2005.02379.x Callose (beta-1,3 glucan) is essential for Arabidopsis pollen wall patterning, but not tube growth.2005 · DOI: 10.1186/1471-2229-5-22
`At5g13000`	Involved in callose synthesis at the forming cell plate during cytokinesis.	No verified direct reference in this release
`At2g31960`	Involved in callose synthesis at the forming cell plate during cytokinesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027246 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002758 innate immune response-activating signaling pathway Biological Process

GO:0006075 (1->3)-beta-D-glucan biosynthetic process Biological Process

GO:0006952 defense response Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0008360 regulation of cell shape Biological Process

GO:0009555 pollen development Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0009620 response to fungus Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0009863 salicylic acid mediated signaling pathway Biological Process

GO:0009965 leaf morphogenesis Biological Process

KEGG gene cross-reference

ath:AT2G13680

ath:AT2G31960

ath:AT4G03550

ath:AT4G04970

ath:AT5G13000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.633

Rank 1 · LXL04_027246 · OH-1004

Endoplasmic reticulum0.197

Rank 2 · LXL04_027246 · OH-1004

Cytoplasm0.109

Rank 3 · LXL04_027246 · OH-1004

Golgi apparatus0.103

Rank 4 · LXL04_027246 · OH-1004

Lysosome / Vacuole0.083

Rank 5 · LXL04_027246 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14288.12FKS1_dom1163-275 aa

PF25968.1CALS1690-870 aa

PF02364.22Glucan_synthase881-1654 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027246	`PF14288.12`	FKS1_dom1	163	275	1.4e-44	151.7
LXL04_027246	`PF25968.1`	CALS1	690	870	1.4e-18	68.0
LXL04_027246	`PF02364.22`	Glucan_synthase	881	1654	2e-255	850.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S9U0`	Arabidopsis thaliana	Callose synthase 11	65.297%	Swiss-Prot	strong database homology
`Q9ZT82`	Arabidopsis thaliana	Callose synthase 12	63.182%	Swiss-Prot	strong database homology
`Q3B724`	Arabidopsis thaliana	Callose synthase 5	46.609%	Swiss-Prot	moderate database homology
`Q9LXT9`	Arabidopsis thaliana	Callose synthase 3	45.252%	Swiss-Prot	moderate database homology
`Q9SL03`	Arabidopsis thaliana	Callose synthase 2	45.287%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card