LXL04_025357 | RubberDandelionOmics

Gene overview

LXL04_025357

Reference: OH-1004 Chr: Chr05 Coordinates: 110283984-110292880 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2025 bp · LXL04_025357|LXL04_025357|OH1004|cDNA

ATGTGCAGCCTGACATGTAGGCCCCTTAACAAGAAAAGCAAGCCCCTAAATATTTCCCAGTTGGTTGCTAGTTTTCAAAATGTACACTATAAAGACAACGTGAAACTTGAAACCTTCACCACATCACAACTTCAATCAAATTCACACTTCAGCAAATTACTTGTATCAATCGATTCATTCTCtcaaaaggattatcttcttTTGCACAAGAAATATGGGTTGCATAAAAGTTCATTAGTTGCAAATGCGAAACAACTTAT...

CDS

Download CDS FASTA

2025 bp · LXL04_025357|LXL04_025357|OH1004|CDS

ATGTGCAGCCTGACATGTAGGCCCCTTAACAAGAAAAGCAAGCCCCTAAATATTTCCCAGTTGGTTGCTAGTTTTCAAAATGTACACTATAAAGACAACGTGAAACTTGAAACCTTCACCACATCACAACTTCAATCAAATTCACACTTCAGCAAATTACTTGTATCAATCGATTCATTCTCTCAAAAGGATTATCTTCTTTTGCACAAGAAATATGGGTTGCATAAAAGTTCATTAGTTGCAAATGCGAAACAACTTAT...

Protein

Download Protein FASTA

674 aa · LXL04_025357|LXL04_025357|OH1004|PROTEIN

MCSLTCRPLNKKSKPLNISQLVASFQNVHYKDNVKLETFTTSQLQSNSHFSKLLVSIDSFSQKDYLLLHKKYGLHKSSLVANAKQLIKIKNTHQRDNVPKGYMAVYVGEVQRKRFVVPLSYLDQPLFQDLLRRSEEEYGFNHPMGGLTIPCQEEAFVHLTTQLLICGNSNDDIRYHFNRSLFTYPTKALTTTKPCIQKENDSALPSNEEARNWVVRWRKVFSWQGMVSPPIGWLNSYSSSDLRNKSWNNGWSRGLHHARL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025357`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025357

Location Chr05:110283984-110292880 (-)

Description Similar to SAUR22: Auxin-responsive protein SAUR22

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g18050`	Functions as a positive effector of cell expansion through modulation of auxin transport.	No verified direct reference in this release
`At5g18080`	Functions as a positive effector of cell expansion through modulation of auxin transport.	No verified direct reference in this release
`At5g18060`	Functions as a positive effector of cell expansion through modulation of auxin transport.	No verified direct reference in this release
`At5g18010`	Provide a mechanistic link between auxin and plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), and triggers PM H(+)-ATPases activity by promoting phosphorylation of their C-terminal autoinhibitory domain as a result of PP2C-D subfamily of type 2C phosphatases inhibition, thus leading to the acidification of the apoplast and the facilitation of solutes and water uptake to drive cell expansion.	The SAUR19 subfamily of SMALL AUXIN UP RNA genes promote cell expansion.2012 · DOI: 10.1111/j.1365-313x.2012.04946.x SAUR Inhibition of PP2C-D Phosphatases Activates Plasma Membrane H+-ATPases to Promote Cell Expansion in Arabidopsis.2014 · DOI: 10.1105/tpc.114.126037 Constitutive Expression of Arabidopsis SMALL AUXIN UP RNA19 (SAUR19) in Tomato Confers Auxin-Independent Hypocotyl Elongation.2017 · DOI: 10.1104/pp.16.01514
`At5g18030`	Functions as a positive effector of cell expansion through modulation of auxin transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025357 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT5G18050

ath:AT5G18060

ath:AT5G18080

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.559

Rank 1 · LXL04_025357 · OH-1004

Cytoplasm0.355

Rank 2 · LXL04_025357 · OH-1004

Cell membrane0.085

Rank 3 · LXL04_025357 · OH-1004

Endoplasmic reticulum0.073

Rank 4 · LXL04_025357 · OH-1004

Mitochondrion0.046

Rank 5 · LXL04_025357 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02519.21Auxin_inducible85-160 aa

PF02519.21Auxin_inducible599-672 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025357	`PF02519.21`	Auxin_inducible	85	160	1.3e-46	157.4
LXL04_025357	`PF02519.21`	Auxin_inducible	599	672	1.3e-46	157.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJF7`	Arabidopsis thaliana	Auxin-responsive protein SAUR22	56.098%	Swiss-Prot	weak database homology
`Q9FK62`	Arabidopsis thaliana	Auxin-responsive protein SAUR24	56.790%	Swiss-Prot	weak database homology
`Q9FJF6`	Arabidopsis thaliana	Auxin-responsive protein SAUR23	67.692%	Swiss-Prot	weak database homology
`Q9FJG1`	Arabidopsis thaliana	Auxin-responsive protein SAUR19	58.025%	Swiss-Prot	weak database homology
`Q9FJF9`	Arabidopsis thaliana	Auxin-responsive protein SAUR21	60.526%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card