LXL04_025035 | RubberDandelionOmics

Gene overview

LXL04_025035

Reference: OH-1004 Chr: Chr05 Coordinates: 104455312-104456989 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

885 bp · LXL04_025035|LXL04_025035|OH1004|cDNA

ATGGAGGCCACAGTTTCCCAAAGCTTGCGCTTGACAACATGGACAAATTCAGATAATACGGTTCCAAAACTGACCAATTCCATGAGGTTATATACAAGATttgagaaaaagaaaaacattaatATGCTTAAATGCAATCATTTGGGAACTATAAAACCAGCAATTGGGCATCGATCAGCAGGGTTAAAGGCTTCATGTGCTTCTCAAAACTCTCCAGCTTCAGTACTCAAGTCCGAAACTTCTATTACTGAAGAGGATTT...

CDS

Download CDS FASTA

885 bp · LXL04_025035|LXL04_025035|OH1004|CDS

ATGGAGGCCACAGTTTCCCAAAGCTTGCGCTTGACAACATGGACAAATTCAGATAATACGGTTCCAAAACTGACCAATTCCATGAGGTTATATACAAGATTTGAGAAAAAGAAAAACATTAATATGCTTAAATGCAATCATTTGGGAACTATAAAACCAGCAATTGGGCATCGATCAGCAGGGTTAAAGGCTTCATGTGCTTCTCAAAACTCTCCAGCTTCAGTACTCAAGTCCGAAACTTCTATTACTGAAGAGGATTT...

Protein

Download Protein FASTA

294 aa · LXL04_025035|LXL04_025035|OH1004|PROTEIN

MEATVSQSLRLTTWTNSDNTVPKLTNSMRLYTRFEKKKNINMLKCNHLGTIKPAIGHRSAGLKASCASQNSPASVLKSETSITEEDLLLKKKCEEIKPCLSGRCIYLVGMMGSGKTTIGQILSEVLDYSFFDSDKLIEQAAGGTAVADIFKLYGEGYFRDNETEVLHKLSLMHGLVISTGGGAVVRPINWKYMHKGITVFIDVPLDTLAQRLTAVGTASRPLLHHGSGDAYNQTFRRLSKLWEERSECYTNASVRVSLER...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025035`
TK1151 ID	TkA06G086150
OH-1004 ID	LXL04_025035
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025035

Location Chr05:104455312-104456989 (-)

Description Similar to SK: Shikimate kinase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21940`	Catalyzes the specific phosphorylation of the 3-hydroxyl group of shikimic acid using ATP as a cosubstrate.	No verified direct reference in this release
`At4g39540`	Catalyzes the specific phosphorylation of the 3-hydroxyl group of shikimic acid using ATP as a cosubstrate.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0640600`	Catalyzes the specific phosphorylation of the 3-hydroxyl group of shikimic acid using ATP as a cosubstrate.	No verified direct reference in this release
`Os02g0749300`	Catalyzes the specific phosphorylation of the 3-hydroxyl group of shikimic acid using ATP as a cosubstrate.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025035 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008652 amino acid biosynthetic process Biological Process

GO:0009073 aromatic amino acid family biosynthetic process Biological Process

GO:0009423 chorismate biosynthetic process Biological Process

GO:0019632 shikimate metabolic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0004765 shikimate kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G21940

ath:AT4G39540

dosa:Os02g0749300

dosa:Os04g0640600

sly:544078

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.933

Rank 1 · LXL04_025035 · OH-1004

Mitochondrion0.083

Rank 2 · LXL04_025035 · OH-1004

Nucleus0.026

Rank 3 · LXL04_025035 · OH-1004

Cytoplasm0.022

Rank 4 · LXL04_025035 · OH-1004

Cell membrane0.011

Rank 5 · LXL04_025035 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13238.13AAA_18105-216 aa

PF01202.29SKI111-263 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025035	`PF13238.13`	AAA_18	105	216	3.2e-07	31.6
LXL04_025035	`PF01202.29`	SKI	111	263	1e-42	146.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJ05`	Arabidopsis thaliana	Shikimate kinase 1, chloroplastic	48.980%	Swiss-Prot	moderate database homology
`Q8GY88`	Arabidopsis thaliana	Shikimate kinase 2, chloroplastic	49.502%	Swiss-Prot	moderate database homology
`Q7X7H9`	Oryza sativa subsp. japonica	Shikimate kinase 3, chloroplastic	51.195%	Swiss-Prot	strong database homology
`Q5NTH4`	Oryza sativa subsp. japonica	Shikimate kinase 1, chloroplastic	53.101%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card