LXL04_024253 | RubberDandelionOmics

Gene overview

LXL04_024253

Reference: OH-1004 Chr: Chr05 Coordinates: 85785266-85788927 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1575 bp · LXL04_024253|LXL04_024253|OH1004|cDNA

GGTGTAAACAGTCTTAATATGGGAATGTTGAATGATGTAAACAACAATGATGGTGGTTCCCCTTTTGATATAAATGATTTCCCTCAATTGAGTAGTCGTCCTAGTTCTTCTGGAGGTCCCCAAGGGCAAATAGGTTCTTTAAGGAAACAGGGACTTGGGGTTAGTCCGATTGTACAGCAAAATCAAGAATTTAGCATACAGAATGAAGACTTTCCTGCATTACCAGGTTTTAAAGGTGGCAAAGCTGATTATGCCATGGA...

CDS

Download CDS FASTA

1557 bp · LXL04_024253|LXL04_024253|OH1004|CDS

ATGGGAATGTTGAATGATGTAAACAACAATGATGGTGGTTCCCCTTTTGATATAAATGATTTCCCTCAATTGAGTAGTCGTCCTAGTTCTTCTGGAGGTCCCCAAGGGCAAATAGGTTCTTTAAGGAAACAGGGACTTGGGGTTAGTCCGATTGTACAGCAAAATCAAGAATTTAGCATACAGAATGAAGACTTTCCTGCATTACCAGGTTTTAAAGGTGGCAAAGCTGATTATGCCATGGATTTGCACCAGAAGGAACA...

Protein

Download Protein FASTA

518 aa · LXL04_024253|LXL04_024253|OH1004|PROTEIN

MGMLNDVNNNDGGSPFDINDFPQLSSRPSSSGGPQGQIGSLRKQGLGVSPIVQQNQEFSIQNEDFPALPGFKGGKADYAMDLHQKEQLHDPNVSIMQSPHFSMGRSSGFSLGGAFSSHRPQQQTSSVSSFAPSNNQELHHMDMFQQGSHSSFHSQPEWELESESLMPMFMALNPEKKTIIQTEYMGVKMVSFGFAGQGRAIMRGPMVSGSADGVLIFGHSLSINESSMTGESKIVHKDHKNPFLESGCKVADGYGIMLAT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_024253`
TK1151 ID	TkA07G331300
OH-1004 ID	LXL04_024253
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	88.200
Protein coverage (%)	TK1151 97.838 / OH-1004 33.784 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_024253

Location Chr05:85785266-85788927 (-)

Description Similar to ACA8: Calcium-transporting ATPase 8, plasma membrane-type

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57110`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell.	No verified direct reference in this release
`At3g21180`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell or into organelles.	No verified direct reference in this release
`At4g29900`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the endoplasmic reticulum.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0605500`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell, into the endoplasmic reticulum, or into organelles (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024253 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009555 pollen development Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0009624 response to nematode Biological Process

GO:0015074 DNA integration Biological Process

GO:0051480 regulation of cytosolic calcium ion concentration Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT3G21180

ath:AT4G29900

ath:AT5G57110

dosa:Os04g0605500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.255

Rank 1 · LXL04_024253 · OH-1004

Cell membrane0.215

Rank 2 · LXL04_024253 · OH-1004

Cytoplasm0.199

Rank 3 · LXL04_024253 · OH-1004

Golgi apparatus0.192

Rank 4 · LXL04_024253 · OH-1004

Nucleus0.186

Rank 5 · LXL04_024253 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00122.26E1-E2_ATPase210-274 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_024253	`PF00122.26`	E1-E2_ATPase	210	274	4.3e-08	33.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LF79`	Arabidopsis thaliana	Calcium-transporting ATPase 8, plasma membrane-type	73.786%	Swiss-Prot	weak database homology
`Q9LU41`	Arabidopsis thaliana	Calcium-transporting ATPase 9, plasma membrane-type	66.667%	Swiss-Prot	weak database homology
`Q9SZR1`	Arabidopsis thaliana	Calcium-transporting ATPase 10, plasma membrane-type	70.388%	Swiss-Prot	weak database homology
`Q7X8B5`	Oryza sativa subsp. japonica	Calcium-transporting ATPase 5, plasma membrane-type	65.339%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card