LXL04_022396 | RubberDandelionOmics

Gene overview

LXL04_022396

Reference: OH-1004 Chr: Chr04 Coordinates: 149509173-149511354 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2025 bp · LXL04_022396|LXL04_022396|OH1004|cDNA

ATGAAATTACCTGTTTATTCAGATGTTGTTGAACCTGTTCAGATTTTGAAACAGCCTGTTTATTTCGATTTTGATTTTGCCATTGAACCTATGAACACAATAGACCCAGGACCTGATTCTTTGCAACAAAGTGAAAATGCGTATTTGACTACTTCAAAATTTGACTCGTATGACGAATTAGTCAAGAGTGTTCGAGAATTCTATTATACAAAAGGTTATGGGATATCTATTCGTGGTTCAAACCCAGACAAATATGTGAT...

CDS

Download CDS FASTA

2025 bp · LXL04_022396|LXL04_022396|OH1004|CDS

ATGAAATTACCTGTTTATTCAGATGTTGTTGAACCTGTTCAGATTTTGAAACAGCCTGTTTATTTCGATTTTGATTTTGCCATTGAACCTATGAACACAATAGACCCAGGACCTGATTCTTTGCAACAAAGTGAAAATGCGTATTTGACTACTTCAAAATTTGACTCGTATGACGAATTAGTCAAGAGTGTTCGAGAATTCTATTATACAAAAGGTTATGGGATATCTATTCGTGGTTCAAACCCAGACAAATATGTGAT...

Protein

Download Protein FASTA

674 aa · LXL04_022396|LXL04_022396|OH1004|PROTEIN

MKLPVYSDVVEPVQILKQPVYFDFDFAIEPMNTIDPGPDSLQQSENAYLTTSKFDSYDELVKSVREFYYTKGYGISIRGSNPDKYVILQCDRGGSYRDIRGISGKRKKSTSTRLINCPFQIVGKKQGHDGAWMIKIKDLSHNHEPSEDISGHPSFRQLPSESVKTVEEMTKAGIPPRQILSSLRQQTPNLPAISRTIYNVKKKIRRQSLGDRPMIQALFDELQEGGFTYDILHNPEGRISRLFIAHPLSIKLAKHFSNIF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022396`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022396

Location Chr04:149509173-149511354 (-)

Description Similar to CHGG_01239: PKS-NRPS hybrid synthetase CHGG_01239 (Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g38180`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release
`At2g32250`	Putative transcription activator involved in regulating light control of development.	No verified direct reference in this release
`At4g15090`	Transcription activator that recognizes and binds to the DNA consensus sequence 5'-CACGCGC-3'.	No verified direct reference in this release
`At3g22170`	Transcription activator that recognizes and binds to the DNA consensus sequence 5'-CACGCGC-3'.	Arabidopsis FHY3 defines a key phytochrome A signaling component directly interacting with its homologous partner FAR1.2002 · DOI: 10.1093/emboj/21.6.1339 The FHY3 and FAR1 genes encode transposase-related proteins involved in regulation of gene expression by the phytochrome A-signaling pathway.2003 · DOI: 10.1046/j.1365-313x.2003.01741.x Arabidopsis FHY3 specifically gates phytochrome signaling to the circadian clock.2006 · DOI: 10.1105/tpc.105.037358 Transposase-derived transcription factors regulate light signaling in Arabidopsis.2007 · DOI: 10.1126/science.1146281 Discrete and essential roles of the multiple domains of Arabidopsis FHY3 in mediating phytochrome A signal transduction.2008 · DOI: 10.1104/pp.108.120436 Transposase-derived proteins FHY3/FAR1 interact with PHYTOCHROME-INTERACTING FACTOR1 to regulate chlorophyll biosynthesis by modulating HEMB1 during deetiolation in Arabidopsis.2012 · DOI: 10.1105/tpc.112.097022

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022396 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009403 toxin biosynthetic process Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0010017 red or far-red light signaling pathway Biological Process

GO:0010018 far-red light signaling pathway Biological Process

GO:0010218 response to far red light Biological Process

GO:0032259 methylation Biological Process

GO:0042753 positive regulation of circadian rhythm Biological Process

KEGG gene cross-reference

ath:AT2G32250

ath:AT3G22170

ath:AT4G15090

ath:AT4G38180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.942

Rank 1 · LXL04_022396 · OH-1004

Cytoplasm0.145

Rank 2 · LXL04_022396 · OH-1004

Mitochondrion0.019

Rank 3 · LXL04_022396 · OH-1004

Cell membrane0.015

Rank 4 · LXL04_022396 · OH-1004

Endoplasmic reticulum0.009

Rank 5 · LXL04_022396 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21056.4ZSWIM1-3_RNaseH-like238-344 aa

PF10551.16MULE260-354 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022396	`PF21056.4`	ZSWIM1-3_RNaseH-like	238	344	4.3e-14	53.3
LXL04_022396	`PF10551.16`	MULE	260	354	4.1e-26	91.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZL8`	Arabidopsis thaliana	Protein FAR1-RELATED SEQUENCE 5	25.407%	Swiss-Prot	weak database homology
`Q3EBQ3`	Arabidopsis thaliana	Protein FAR1-RELATED SEQUENCE 2	25.326%	Swiss-Prot	weak database homology
`Q9SWG3`	Arabidopsis thaliana	Protein FAR-RED IMPAIRED RESPONSE 1	22.637%	Swiss-Prot	weak database homology
`Q9LIE5`	Arabidopsis thaliana	Protein FAR-RED ELONGATED HYPOCOTYL 3	22.014%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card