LXL04_021844 | RubberDandelionOmics

Gene overview

LXL04_021844

Reference: OH-1004 Chr: Chr04 Coordinates: 138523851-138527856 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1161 bp · LXL04_021844|LXL04_021844|OH1004|cDNA

ATGGCTTCATCGACACAAGATCATCAACACCACTTTCCGACGGCGATCGGCACTACATCAGCTCCACCACCAACACCTTCCACCACCCAACCTAATTTCACCTCCACCTCAGACTCCTCCGCCACCGATCTTCTCTCCCGTCTTCTTCACCGTCTCCCGCCAACTCTCTCAAACACTCCTCTATTACTCCGCCGCCGTTCTTCACTCGCCACCACCACCAGTACCACCACCTCTCCTCCGTCACTCCCCTTCCCCGAGCT...

CDS

Download CDS FASTA

1161 bp · LXL04_021844|LXL04_021844|OH1004|CDS

ATGGCTTCATCGACACAAGATCATCAACACCACTTTCCGACGGCGATCGGCACTACATCAGCTCCACCACCAACACCTTCCACCACCCAACCTAATTTCACCTCCACCTCAGACTCCTCCGCCACCGATCTTCTCTCCCGTCTTCTTCACCGTCTCCCGCCAACTCTCTCAAACACTCCTCTATTACTCCGCCGCCGTTCTTCACTCGCCACCACCACCAGTACCACCACCTCTCCTCCGTCACTCCCCTTCCCCGAGCT...

Protein

Download Protein FASTA

386 aa · LXL04_021844|LXL04_021844|OH1004|PROTEIN

MASSTQDHQHHFPTAIGTTSAPPPTPSTTQPNFTSTSDSSATDLLSRLLHRLPPTLSNTPLLLRRRSSLATTTSTTTSPPSLPFPELNSSLSTTLPSISELGFFQLTNHSIPSDLARAAESDSISLFNLPRHLKHQHFPRIWPLGFDDDDNEEEEDTGAGDSLILDSSCSTDSSELSLNSLREFTREMEKIGFAVVEALFSAMGLQNPAGDDPAGLSSLVWVSNSSGFTDSKLDGSGKFYPYVIGLHYQFRSKSCSLLAD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021844`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021844

Location Chr04:138523851-138527856 (-)

Description Similar to GA2OX2: Gibberellin 2-beta-dioxygenase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g30040`	Catalyzes the 2-beta-hydroxylation of several biologically active gibberellins, leading to the homeostatic regulation of their endogenous level.	No verified direct reference in this release
`At1g78440`	Catalyzes the 2-beta-hydroxylation of several biologically active gibberellins, leading to the homeostatic regulation of their endogenous level.	No verified direct reference in this release
`At2g34555`	Catalyzes the 2-beta-hydroxylation of several biologically active gibberellins, leading to the homeostatic regulation of their endogenous level.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021844 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0009686 gibberellin biosynthetic process Biological Process

GO:0010114 response to red light Biological Process

GO:0045487 gibberellin catabolic process Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0045543 gibberellin 2-beta-dioxygenase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051213 dioxygenase activity Molecular Function

KEGG gene cross-reference

ath:AT1G30040

ath:AT1G78440

ath:AT2G34555

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.740

Rank 1 · LXL04_021844 · OH-1004

Cytoplasm0.356

Rank 2 · LXL04_021844 · OH-1004

Cell membrane0.044

Rank 3 · LXL04_021844 · OH-1004

Endoplasmic reticulum0.043

Rank 4 · LXL04_021844 · OH-1004

Plastid0.026

Rank 5 · LXL04_021844 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226.13DIOX_N99-137 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021844	`PF14226.13`	DIOX_N	99	137	7.8e-06	27.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XFR9`	Arabidopsis thaliana	Gibberellin 2-beta-dioxygenase 2	21.935%	Swiss-Prot	weak database homology
`Q8LEA2`	Arabidopsis thaliana	Gibberellin 2-beta-dioxygenase 1	23.864%	Swiss-Prot	weak database homology
`O64692`	Arabidopsis thaliana	Gibberellin 2-beta-dioxygenase 3	23.103%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card