LXL04_021422 | RubberDandelionOmics

Gene overview

LXL04_021422

Reference: OH-1004 Chr: Chr04 Coordinates: 129571487-129571975 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

489 bp · LXL04_021422|LXL04_021422|OH1004|cDNA

ATGGCTCAACTCCCATCCAACCAATTCCAACAAGTCAACCAATTAAAAGACATTTTCACCCGCTTTGACCTCGATTCCGACGGCAGCCTCACCCATCTAGAACTCGCGGCCCTCTTCCGTGCTGTGGGTCTCAAACCAGGCAACGAAACCGACGACTTGGTAGCCAAATTGGACGCGAATGGAAACGGTTCCATCGAATTTGAAGAATTACTGAACGCCATTTTCCCCAATCCGACTGACGAGGTTTTCATCGACCATGA...

CDS

Download CDS FASTA

489 bp · LXL04_021422|LXL04_021422|OH1004|CDS

ATGGCTCAACTCCCATCCAACCAATTCCAACAAGTCAACCAATTAAAAGACATTTTCACCCGCTTTGACCTCGATTCCGACGGCAGCCTCACCCATCTAGAACTCGCGGCCCTCTTCCGTGCTGTGGGTCTCAAACCAGGCAACGAAACCGACGACTTGGTAGCCAAATTGGACGCGAATGGAAACGGTTCCATCGAATTTGAAGAATTACTGAACGCCATTTTCCCCAATCCGACTGACGAGGTTTTCATCGACCATGA...

Protein

Download Protein FASTA

162 aa · LXL04_021422|LXL04_021422|OH1004|PROTEIN

MAQLPSNQFQQVNQLKDIFTRFDLDSDGSLTHLELAALFRAVGLKPGNETDDLVAKLDANGNGSIEFEELLNAIFPNPTDEVFIDHDQLMKAFQLFDKDGDGSITPLELASQMAKMGHPLTYRELNDLMNDIDTDGDGIISFHEFSAVFGMPASEFFGIKTL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021422`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021422

Location Chr04:129571487-129571975 (-)

Description Similar to CML16: Probable calcium-binding protein CML16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25600`	Potential calcium sensor.	No verified direct reference in this release
`At1g18530`	Potential calcium sensor.	No verified direct reference in this release
`At1g32250`	Potential calcium sensor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0577500`	Potential calcium sensor.	No verified direct reference in this release
`Os01g0604500`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021422 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005509 calcium ion binding Molecular Function

GO:0030234 enzyme regulator activity Molecular Function

KEGG gene cross-reference

ath:AT1G18530

ath:AT1G32250

ath:AT3G25600

dosa:Os01g0604500

dosa:Os05g0577500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.458

Rank 1 · LXL04_021422 · OH-1004

Nucleus0.224

Rank 2 · LXL04_021422 · OH-1004

Plastid0.128

Rank 3 · LXL04_021422 · OH-1004

Endoplasmic reticulum0.088

Rank 4 · LXL04_021422 · OH-1004

Lysosome / Vacuole0.083

Rank 5 · LXL04_021422 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13499.13EF-hand_713-73 aa

PF13405.13EF-hand_614-43 aa

PF00036.39EF-hand_115-41 aa

PF13499.13EF-hand_787-149 aa

PF21008.4AIF-187-146 aa

PF13405.13EF-hand_688-116 aa

PF00036.39EF-hand_189-116 aa

PF13202.13EF-hand_591-110 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021422	`PF13499.13`	EF-hand_7	13	73	8.3e-28	97.2
LXL04_021422	`PF13405.13`	EF-hand_6	14	43	2.6e-24	83.3
LXL04_021422	`PF00036.39`	EF-hand_1	15	41	2.6e-25	86.8
LXL04_021422	`PF13499.13`	EF-hand_7	87	149	8.3e-28	97.2
LXL04_021422	`PF21008.4`	AIF-1	87	146	1.4e-06	29.3
LXL04_021422	`PF13405.13`	EF-hand_6	88	116	2.6e-24	83.3
LXL04_021422	`PF00036.39`	EF-hand_1	89	116	2.6e-25	86.8
LXL04_021422	`PF13202.13`	EF-hand_5	91	110	5.4e-22	76.9
LXL04_021422	`PF13833.13`	EF-hand_8	113	147	3.5e-12	46.6
LXL04_021422	`PF00036.39`	EF-hand_1	124	149	2.6e-25	86.8
LXL04_021422	`PF13202.13`	EF-hand_5	125	148	5.4e-22	76.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LI84`	Arabidopsis thaliana	Probable calcium-binding protein CML16	57.333%	Swiss-Prot	strong database homology
`Q9FZ75`	Arabidopsis thaliana	Probable calcium-binding protein CML15	53.642%	Swiss-Prot	strong database homology
`Q9LQN4`	Arabidopsis thaliana	Probable calcium-binding protein CML17	42.282%	Swiss-Prot	moderate database homology
`Q6L5F4`	Oryza sativa subsp. japonica	Probable calcium-binding protein CML14	52.980%	Swiss-Prot	strong database homology
`Q5ZD81`	Oryza sativa subsp. japonica	Probable calcium-binding protein CML12	50.314%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card