LXL04_021364 | RubberDandelionOmics

Gene overview

LXL04_021364

Reference: OH-1004 Chr: Chr04 Coordinates: 128224615-128225239 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

470 bp · LXL04_021364|LXL04_021364|OH1004|cDNA

ATGCGAAATCGGTTAGTCTTTTACCTTATTTCATTTACTTTTTACATTGTAATCATGGCTCCCATGGGAGCTGCACAGTCAGCAGCAAAGGAGCTTCTTGATTCCATTCTAGATGCCATTGTTCGGATATTCGATAACCATGCGGTGGTTGGAGAGCTTCTTGAAGCGAAATCTTCTCAGCATGCAGCTATGAACACACCAAAATCTATGGTGGCTACATTATCTGGGATCCCTGATTCTGAAGCATCTAAGGATACAGG...

CDS

Download CDS FASTA

372 bp · LXL04_021364|LXL04_021364|OH1004|CDS

ATGCGAAATCGGTTAGTCTTTTACCTTATTTCATTTACTTTTTACATTGTAATCATGGCTCCCATGGGAGCTGCACAGTCAGCAGCAAAGGAGCTTCTTGATTCCATTCTAGATGCCATTGTTCGGATATTCGATAACCATGCGGTGGTTGGAGAGCTTCTTGAAGCGAAATCTTCTCAGCATGCAGCTATGAACACACCAAAATCTATGGTGGCTACATTATCTGGGATCCCTGATTCTGAAGCATCTAAGGATACAGG...

Protein

Download Protein FASTA

123 aa · LXL04_021364|LXL04_021364|OH1004|PROTEIN

MRNRLVFYLISFTFYIVIMAPMGAAQSAAKELLDSILDAIVRIFDNHAVVGELLEAKSSQHAAMNTPKSMVATLSGIPDSEASKDTGGYTISFSMTVLQSECQQLICEILRATPEAASADAAV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021364`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021364

Location Chr04:128224615-128225239 (-)

Description Similar to SEC8: Exocyst complex component SEC8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g10380`	Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane during regulated or polarized secretion.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021364 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006887 exocytosis Biological Process

GO:0006893 Golgi to plasma membrane transport Biological Process

GO:0006904 vesicle docking involved in exocytosis Biological Process

GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process

GO:0060321 acceptance of pollen Biological Process

GO:0090522 vesicle tethering involved in exocytosis Biological Process

GO:0000145 exocyst Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009524 phragmoplast Cellular Component

KEGG gene cross-reference

ath:AT3G10380

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.385

Rank 1 · LXL04_021364 · OH-1004

Cytoplasm0.156

Rank 2 · LXL04_021364 · OH-1004

Mitochondrion0.139

Rank 3 · LXL04_021364 · OH-1004

Extracellular0.135

Rank 4 · LXL04_021364 · OH-1004

Nucleus0.104

Rank 5 · LXL04_021364 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YU5`	Arabidopsis thaliana	Exocyst complex component SEC8	70.408%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card