LXL04_020297 | RubberDandelionOmics

Gene overview

LXL04_020297

Reference: OH-1004 Chr: Chr04 Coordinates: 64469032-64470715 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

792 bp · LXL04_020297|LXL04_020297|OH1004|cDNA

ATGAACACTAGGAGGCTGCACACGCAATGGGGGCATTTTAGTCTTTCAGCCAGTTCTAATGTCGTTAAGAAGCAGTGGAAAAGTAATCAGCATATGAGACATTTATGGCTTTTTCTGATCAGAAGGCTGCAGCAAAATCACTGGGGGCATTGTTGGAATAGCTTCAAAAGAACTCCAAGGTTGGAGGTGGGTCTGTTGCGGGATCAAATTAATTTTAACTGCCGAGGGCAGTTTTGGCATTTTGGGATTTGGCAGCCTTT...

CDS

Download CDS FASTA

792 bp · LXL04_020297|LXL04_020297|OH1004|CDS

ATGAACACTAGGAGGCTGCACACGCAATGGGGGCATTTTAGTCTTTCAGCCAGTTCTAATGTCGTTAAGAAGCAGTGGAAAAGTAATCAGCATATGAGACATTTATGGCTTTTTCTGATCAGAAGGCTGCAGCAAAATCACTGGGGGCATTGTTGGAATAGCTTCAAAAGAACTCCAAGGTTGGAGGTGGGTCTGTTGCGGGATCAAATTAATTTTAACTGCCGAGGGCAGTTTTGGCATTTTGGGATTTGGCAGCCTTT...

Protein

Download Protein FASTA

263 aa · LXL04_020297|LXL04_020297|OH1004|PROTEIN

MNTRRLHTQWGHFSLSASSNVVKKQWKSNQHMRHLWLFLIRRLQQNHWGHCWNSFKRTPRLEVGLLRDQINFNCRGQFWHFGIWQPFFCIGIWQLLDLMFKWLHMEESLTGKTAFGSELTGKIATEGIFGMWLQVRDAGNLLTRAGFTLPGVDVDEYQVRYNSALELIEHLRAMGETNALVNRIKFLKRDTALATAAVYESMFAAEDGTIPATFQVIYMMGWKEHESQQKAKRWGSATLSFKDIQKELTFYSILMLIHVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020297`
TK1151 ID	TkA06G160350
OH-1004 ID	LXL04_020297
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	95.800
Protein coverage (%)	TK1151 48.000 / OH-1004 18.251 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020297

Location Chr04:64469032-64470715 (-)

Description Similar to At1g22800: Putative methyltransferase At1g22800, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g22800`	Putative methyltransferase At1g22800, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020297 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0032259 methylation Biological Process

GO:0032981 mitochondrial respiratory chain complex I assembly Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0099617 matrix side of mitochondrial inner membrane Cellular Component

GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT1G22800

dre:794020

hsa:79133

pon:100172355

rno:296190

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.389

Rank 1 · LXL04_020297 · OH-1004

Nucleus0.257

Rank 2 · LXL04_020297 · OH-1004

Mitochondrion0.227

Rank 3 · LXL04_020297 · OH-1004

Peroxisome0.091

Rank 4 · LXL04_020297 · OH-1004

Endoplasmic reticulum0.073

Rank 5 · LXL04_020297 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80543`	Arabidopsis thaliana	Putative methyltransferase At1g22800, mitochondrial	75.439%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card