LXL04_020056 | RubberDandelionOmics

Gene overview

LXL04_020056

Reference: OH-1004 Chr: Chr04 Coordinates: 49347724-49349645 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

768 bp · LXL04_020056|LXL04_020056|OH1004|cDNA

ATGGTACTTAAGAAGACGTTACAAACCATCTGCCTTCTGAATGTTCATCCCAATACAACAACTTCAATTGTCATCCAGGTTGTCAATGACGATGGTGCTCTTCTTCCTTGTGCAATAAATGCAGCTTGTGCTGCTCTCGTAGATGCTGGAACTCCTTTAAAGCATCTTGCAGAAATGAACCCTTTCACCTTGGTTGATGGAAAACCTTACCCTCTTGATATGAGAGGAGAGCTTGATGATACTGCTgctttcaagaactt...

CDS

Download CDS FASTA

768 bp · LXL04_020056|LXL04_020056|OH1004|CDS

ATGGTACTTAAGAAGACGTTACAAACCATCTGCCTTCTGAATGTTCATCCCAATACAACAACTTCAATTGTCATCCAGGTTGTCAATGACGATGGTGCTCTTCTTCCTTGTGCAATAAATGCAGCTTGTGCTGCTCTCGTAGATGCTGGAACTCCTTTAAAGCATCTTGCAGAAATGAACCCTTTCACCTTGGTTGATGGAAAACCTTACCCTCTTGATATGAGAGGAGAGCTTGATGATACTGCTGCTTTCAAGAACTT...

Protein

Download Protein FASTA

255 aa · LXL04_020056|LXL04_020056|OH1004|PROTEIN

MVLKKTLQTICLLNVHPNTTTSIVIQVVNDDGALLPCAINAACAALVDAGTPLKHLAEMNPFTLVDGKPYPLDMRGELDDTAAFKNFKNASLKFTVLNPKGRIWTMVAGGGASVIYAYTVFGDLGYASELGNYAEYSGAPNEEEVLQYARVVIDCATADPDGQKRALVVGGGIANFTDVAATFNGIIRAMKEKEAKLKAANMHIYVRRGGPNYQRGLARMRALGDEIGIPIEVYGPEATMTGICKQAIDCITASA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020056`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020056

Location Chr04:49347724-49349645 (+)

Description Similar to ACLA-2: ATP-citrate synthase alpha chain protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60810`	ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA, used for the elongation of fatty acids and biosynthesis of isoprenoids, flavonoids and malonated derivatives.	No verified direct reference in this release
`At1g10670`	ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA, used for the elongation of fatty acids and biosynthesis of isoprenoids, flavonoids and malonated derivatives.	Molecular characterization of a heteromeric ATP-citrate lyase that generates cytosolic acetyl-coenzyme A in Arabidopsis.2002 · DOI: 10.1104/pp.008110
`At1g09430`	ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA, used for the elongation of fatty acids and biosynthesis of isoprenoids, flavonoids and malonated derivatives.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0566300`	ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA, used for the elongation of fatty acids and biosynthesis of isoprenoids, flavonoids and malonated derivatives.	No verified direct reference in this release
`Os11g0696200`	ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA, used for the elongation of fatty acids and biosynthesis of isoprenoids, flavonoids and malonated derivatives.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020056 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006085 acetyl-CoA biosynthetic process Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0015995 chlorophyll biosynthetic process Biological Process

GO:0016117 carotenoid biosynthetic process Biological Process

GO:0019252 starch biosynthetic process Biological Process

GO:0043481 anthocyanin accumulation in tissues in response to UV light Biological Process

GO:0045793 positive regulation of cell size Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0048366 leaf development Biological Process

KEGG gene cross-reference

ath:AT1G09430

ath:AT1G10670

ath:AT1G60810

dosa:Os12g0566300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.628

Rank 1 · LXL04_020056 · OH-1004

Nucleus0.205

Rank 2 · LXL04_020056 · OH-1004

Mitochondrion0.136

Rank 3 · LXL04_020056 · OH-1004

Cell membrane0.096

Rank 4 · LXL04_020056 · OH-1004

Extracellular0.089

Rank 5 · LXL04_020056 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01138.28RNase_PH2-52 aa

PF16114.11Citrate_bind88-249 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020056	`PF01138.28`	RNase_PH	2	52	3.6e-10	41.1
LXL04_020056	`PF16114.11`	Citrate_bind	88	249	7.9e-76	254.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22718`	Arabidopsis thaliana	ATP-citrate synthase alpha chain protein 2	78.414%	Swiss-Prot	strong database homology
`Q9SGY2`	Arabidopsis thaliana	ATP-citrate synthase alpha chain protein 1	71.206%	Swiss-Prot	strong database homology
`O80526`	Arabidopsis thaliana	ATP-citrate synthase alpha chain protein 3	77.130%	Swiss-Prot	strong database homology
`Q2QNG7`	Oryza sativa subsp. japonica	ATP-citrate synthase alpha chain protein 3	76.211%	Swiss-Prot	strong database homology
`Q2QZ86`	Oryza sativa subsp. japonica	ATP-citrate synthase alpha chain protein 2	75.771%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card