LXL04_019852 | RubberDandelionOmics

Gene overview

LXL04_019852

Reference: OH-1004 Chr: Chr04 Coordinates: 41913875-41916253 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1257 bp · LXL04_019852|LXL04_019852|OH1004|cDNA

ATGAGCGGACACGATTCGAAGTACTTTTCCACAACTAAAAAGGGTGAAATCCCCGAGCTCAAAGAAGAACTCAATTCGCAGTACAAGGATAAGAGAAAAGATGCTGTTAAAAAGGTGATTGCTGCCATGACTGTTGGGAAGGACGAGTCATCACTATTCACAGATGTCCTGAACTGTATGCAGACAGAAAATTTGGAGCTCAAGAAGCTTGTTTACTTGTATCTCATCAATTATGCTAAAAGCCAACCTGACCTAGCAAT...

CDS

Download CDS FASTA

1257 bp · LXL04_019852|LXL04_019852|OH1004|CDS

ATGAGCGGACACGATTCGAAGTACTTTTCCACAACTAAAAAGGGTGAAATCCCCGAGCTCAAAGAAGAACTCAATTCGCAGTACAAGGATAAGAGAAAAGATGCTGTTAAAAAGGTGATTGCTGCCATGACTGTTGGGAAGGACGAGTCATCACTATTCACAGATGTCCTGAACTGTATGCAGACAGAAAATTTGGAGCTCAAGAAGCTTGTTTACTTGTATCTCATCAATTATGCTAAAAGCCAACCTGACCTAGCAAT...

Protein

Download Protein FASTA

418 aa · LXL04_019852|LXL04_019852|OH1004|PROTEIN

MSGHDSKYFSTTKKGEIPELKEELNSQYKDKRKDAVKKVIAAMTVGKDESSLFTDVLNCMQTENLELKKLVYLYLINYAKSQPDLAILADSQDPNPLIRALAVRTMGCIRVDKITEYLCDTLQRCLKDDDPYVRKTAAICVAKLYDINAELVEDRGFLEALKDLISDNNPMVVANAVAALAEIQDNSSKPIFDLTTSTLTKLLTALNECTEWGQVFILDALSKYKASCIDMRKYQYTEMLCCEGHDCLLAYLNTGAQKKR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019852`
TK1151 ID	TkA07G307520
OH-1004 ID	LXL04_019852
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	52.400
Protein coverage (%)	TK1151 59.770 / OH-1004 25.120 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019852

Location Chr04:41913875-41916253 (+)

Description Similar to BETAC-AD: Beta-adaptin-like protein C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g23460`	Subunit of clathrin-associated adaptor protein complex that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes.	No verified direct reference in this release
`At4g11380`	Subunit of clathrin-associated adaptor protein complex that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019852 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0045807 positive regulation of endocytosis Biological Process

GO:0048268 clathrin coat assembly Biological Process

GO:0072583 clathrin-dependent endocytosis Biological Process

GO:1905477 positive regulation of protein localization to membrane Biological Process

GO:0005634 nucleus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009898 cytoplasmic side of plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT4G11380

ath:AT4G23460

hsa:163

mmu:71770

rno:140670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.774

Rank 1 · LXL04_019852 · OH-1004

Cytoplasm0.243

Rank 2 · LXL04_019852 · OH-1004

Cell membrane0.043

Rank 3 · LXL04_019852 · OH-1004

Mitochondrion0.037

Rank 4 · LXL04_019852 · OH-1004

Endoplasmic reticulum0.030

Rank 5 · LXL04_019852 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01602.27Adaptin_N14-227 aa

PF20168.5PDS517-193 aa

PF13646.13HEAT_292-146 aa

PF12717.14Cnd197-226 aa

PF02985.29HEAT119-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019852	`PF01602.27`	Adaptin_N	14	227	3e-65	221.5
LXL04_019852	`PF20168.5`	PDS5	17	193	9e-07	27.8
LXL04_019852	`PF13646.13`	HEAT_2	92	146	3.7e-14	53.5
LXL04_019852	`PF12717.14`	Cnd1	97	226	4.6e-50	170.6
LXL04_019852	`PF02985.29`	HEAT	119	145	3.6e-11	42.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81742`	Arabidopsis thaliana	Beta-adaptin-like protein C	90.987%	Swiss-Prot	moderate database homology
`Q9SUS3`	Arabidopsis thaliana	Beta-adaptin-like protein B	91.845%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card