Gene Card
Gene overview
cDNA / CDS / Protein Sequences
501 bp · LXL04_019758|LXL04_019758|OH1004|cDNA
ATGGGGGCACTGATGAAGCTAATCGACGTAATCCTGTTCATCATGTTCCTCGTAATCGCAATTGCAGCTCCACTTCTCGATGCTCAAACCTGTTTTCCTTCCAATATGTTTCCGAGCGTACTGTTAAACCTCAAGACATGGTACACCCACGAATACCGAGATTACTTGGTCTCCGAAAAACCCCATTTCTTCGTTGGCCTTATTTGGCTCGAGCTTCTCTTCGCATGGCCCCTCTCGATTGCTTCTCTCTATGGGATCGT...
501 bp · LXL04_019758|LXL04_019758|OH1004|CDS
ATGGGGGCACTGATGAAGCTAATCGACGTAATCCTGTTCATCATGTTCCTCGTAATCGCAATTGCAGCTCCACTTCTCGATGCTCAAACCTGTTTTCCTTCCAATATGTTTCCGAGCGTACTGTTAAACCTCAAGACATGGTACACCCACGAATACCGAGATTACTTGGTCTCCGAAAAACCCCATTTCTTCGTTGGCCTTATTTGGCTCGAGCTTCTCTTCGCATGGCCCCTCTCGATTGCTTCTCTCTATGGGATCGT...
Protein
Download Protein FASTA166 aa · LXL04_019758|LXL04_019758|OH1004|PROTEIN
MGALMKLIDVILFIMFLVIAIAAPLLDAQTCFPSNMFPSVLLNLKTWYTHEYRDYLVSEKPHFFVGLIWLELLFAWPLSIASLYGIVAGKSWLRTTCLLYGVSTMTAMVAILSELVGSGKASAKLLKMYSPFMGFAVLAILRGLLPNSPNSNSVGTKPAFARKKRA
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_019758 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_019758 |
|---|---|
| Location | Chr04:39356155-39356972 (+) |
| Description | Similar to TMEM97: Sigma intracellular receptor 2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0001558 regulation of cell growth Biological Process GO:0032377 regulation of intracellular lipid transport Biological Process GO:0032383 regulation of intracellular cholesterol transport Biological Process GO:0042632 cholesterol homeostasis Biological Process GO:0140077 positive regulation of lipoprotein transport Biological Process GO:0005764 lysosome Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005791 rough endoplasmic reticulum Cellular Component GO:0005886 plasma membrane Cellular Component GO:0030867 rough endoplasmic reticulum membrane Cellular Component GO:0031965 nuclear membrane Cellular Component GO:0008142 oxysterol binding Molecular Function |
| KEGG gene cross-reference | bta:511378 hsa:27346 mmu:69071 rno:303330 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF05241.18EBP41-140 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_019758 | PF05241.18 | EBP | 41 | 140 | 2.3e-13 | 51.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.