LXL04_019690 | RubberDandelionOmics

Gene overview

LXL04_019690

Reference: OH-1004 Chr: Chr04 Coordinates: 36962452-36966258 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2181 bp · LXL04_019690|LXL04_019690|OH1004|cDNA

ATGCGTTTACATTCCCCTATCTTATCATCACTCGCATACCACCGCATCATCTCCAGCTTCCGCCCCATATCTTCTCTACAACGACCGGCCGACGTCATCGCACCCATGGCTACCTCCGAGGACTCACTCCGAAGAGCTCTTGCTGAGAAACAATCCACGATCGATGCTAGCGGCAACGCGATACGTCAATTGAAGTCTTCCGGCGCATCAAAGACGGATATAGACGAGGCCGTTAAAGCACTTAATGCATTGAAACTCGA...

CDS

Download CDS FASTA

2181 bp · LXL04_019690|LXL04_019690|OH1004|CDS

ATGCGTTTACATTCCCCTATCTTATCATCACTCGCATACCACCGCATCATCTCCAGCTTCCGCCCCATATCTTCTCTACAACGACCGGCCGACGTCATCGCACCCATGGCTACCTCCGAGGACTCACTCCGAAGAGCTCTTGCTGAGAAACAATCCACGATCGATGCTAGCGGCAACGCGATACGTCAATTGAAGTCTTCCGGCGCATCAAAGACGGATATAGACGAGGCCGTTAAAGCACTTAATGCATTGAAACTCGA...

Protein

Download Protein FASTA

726 aa · LXL04_019690|LXL04_019690|OH1004|PROTEIN

MRLHSPILSSLAYHRIISSFRPISSLQRPADVIAPMATSEDSLRRALAEKQSTIDASGNAIRQLKSSGASKTDIDEAVKALNALKLEKTSIETQLKASISGDANGSVLSREAFRQAVVNTLERRLFYIPSFKIYRGVAGLYDYGPPGCAVKSNVLSFWRQHFVLEEDMLEVDCPCVTPEVVLKASGHVDKFTDLMVKDEKTGTCYRADHLLKDHCKDKLEKDLTITSEKAAELKHILAVLDDLSAEQLGAKIKEYGIVAP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019690`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019690

Location Chr04:36962452-36966258 (-)

Description Similar to At1g29880: Glycine--tRNA ligase, mitochondrial 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g29880`	Catalyzes the ATP-dependent ligation of glycine to the 3'-end of its cognate tRNA, via the formation of an aminoacyl-adenylate intermediate (Gly-AMP).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019690 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006418 tRNA aminoacylation for protein translation Biological Process

GO:0006426 glycyl-tRNA aminoacylation Biological Process

GO:0015966 diadenosine tetraphosphate biosynthetic process Biological Process

GO:0070150 mitochondrial glycyl-tRNA aminoacylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G29880

hsa:2617

mmu:353172

pon:100174405

rno:297113

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.497

Rank 1 · LXL04_019690 · OH-1004

Cytoplasm0.380

Rank 2 · LXL04_019690 · OH-1004

Nucleus0.152

Rank 3 · LXL04_019690 · OH-1004

Plastid0.070

Rank 4 · LXL04_019690 · OH-1004

Peroxisome0.069

Rank 5 · LXL04_019690 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00458.26WHEP-TRS53-89 aa

PF00587.31tRNA-synt_2b289-587 aa

PF03129.26HGTP_anticodon614-701 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019690	`PF00458.26`	WHEP-TRS	53	89	5e-10	40.0
LXL04_019690	`PF00587.31`	tRNA-synt_2b	289	587	5.2e-11	43.6
LXL04_019690	`PF03129.26`	HGTP_anticodon	614	701	2.8e-18	66.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23627`	Arabidopsis thaliana	Glycine--tRNA ligase, mitochondrial 1	77.060%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card