LXL04_019484 | RubberDandelionOmics

Gene overview

LXL04_019484

Reference: OH-1004 Chr: Chr04 Coordinates: 32339567-32343458 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1764 bp · LXL04_019484|LXL04_019484|OH1004|cDNA

ATGGTTGCGGTTTTTGTTTCTCCAACGACGAGGGTATCTTCAACGAAGATGTTCTCGTCTTTATCTCGCCGTCAATGCATTTCTTATGTTTATTCTTCTACTACATTACGCTCTTCTCCCTGTAGATTGATCCCTCGTTTTCCTAATTTAAGGCTGAACCATTTCTATACAAGATGCTCCATGACAAATACCGAACTCTTGAATAATATCATCACAGAAGAAGTTCATCATGATTCATCAGTTGATGCATCAAGTTGTTC...

CDS

Download CDS FASTA

1764 bp · LXL04_019484|LXL04_019484|OH1004|CDS

ATGGTTGCGGTTTTTGTTTCTCCAACGACGAGGGTATCTTCAACGAAGATGTTCTCGTCTTTATCTCGCCGTCAATGCATTTCTTATGTTTATTCTTCTACTACATTACGCTCTTCTCCCTGTAGATTGATCCCTCGTTTTCCTAATTTAAGGCTGAACCATTTCTATACAAGATGCTCCATGACAAATACCGAACTCTTGAATAATATCATCACAGAAGAAGTTCATCATGATTCATCAGTTGATGCATCAAGTTGTTC...

Protein

Download Protein FASTA

587 aa · LXL04_019484|LXL04_019484|OH1004|PROTEIN

MVAVFVSPTTRVSSTKMFSSLSRRQCISYVYSSTTLRSSPCRLIPRFPNLRLNHFYTRCSMTNTELLNNIITEEVHHDSSVDASSCSVPIIHLNSEIHDTESANLLVEGTFVDMILTTLPILSEEEQDVIAAMPAHPAGLYALYASCLAGNLVEQLWNFAWPAAIALLHPSLLPVAVMGFCTKVAVIAGGPLVGKLMDSFPRVPAYNVLTTIQACAQMLSAGMIIQAHMAHASLATSVLMRPWFIILVLAGAVERLSGLA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019484`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019484

Location Chr04:32339567-32343458 (-)

Description Similar to IREG3: Solute carrier family 40 member 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g26820`	Probable plastid transporter that may play a role in iron chelation, storage or sequestration under limiting iron conditions.	Multiple antibiotic resistance in Arabidopsis is conferred by mutations in a chloroplast-localized transport protein.2009 · DOI: 10.1104/pp.109.143487 The MAR1 transporter is an opportunistic entry point for antibiotics.2010 · DOI: 10.4161/psb.5.1.10142
`At2g38460`	May be involved in iron transport and iron homeostasis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0562100`	May be involved in iron transport and iron homeostasis.	No verified direct reference in this release
`Os05g0131500`	May be involved in iron transport and iron homeostasis.	No verified direct reference in this release
`Os06g0560000`	May be involved in iron transport and iron homeostasis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019484 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006824 cobalt ion transport Biological Process

GO:0006826 iron ion transport Biological Process

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016020 membrane Cellular Component

GO:0005381 iron ion transmembrane transporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G38460

ath:AT5G26820

dosa:Os06g0560000

dosa:Os12g0562100

osa:107276535

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.960

Rank 1 · LXL04_019484 · OH-1004

Mitochondrion0.035

Rank 2 · LXL04_019484 · OH-1004

Cytoplasm0.030

Rank 3 · LXL04_019484 · OH-1004

Nucleus0.028

Rank 4 · LXL04_019484 · OH-1004

Peroxisome0.026

Rank 5 · LXL04_019484 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06963.19FPN1139-563 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019484	`PF06963.19`	FPN1	139	563	6.9e-120	401.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W4E7`	Arabidopsis thaliana	Solute carrier family 40 member 3, chloroplastic	64.568%	Swiss-Prot	strong database homology
`O80905`	Arabidopsis thaliana	Solute carrier family 40 member 1	24.622%	Swiss-Prot	weak database homology
`Q2QNK7`	Oryza sativa subsp. japonica	Solute carrier family 40 member 2, chloroplastic	57.615%	Swiss-Prot	strong database homology
`B9FGV7`	Oryza sativa subsp. japonica	Solute carrier family 40 member 3, chloroplastic	51.828%	Swiss-Prot	strong database homology
`Q5Z922`	Oryza sativa subsp. japonica	Solute carrier family 40 member 1	28.539%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card