LXL04_018780 | RubberDandelionOmics

Gene overview

LXL04_018780

Reference: OH-1004 Chr: Chr04 Coordinates: 18136391-18140023 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1179 bp · LXL04_018780|LXL04_018780|OH1004|cDNA

atgccacatggcaccatcttattcaatctcacaaatattttcccgcctaaactcaattacatgTTGTTTCCGATCGTTCATCATCAATCTCGATTTAACTCAACTGAAATAATGGCTTCTTCAATGCTGTATGGAGCTGAGAATCTCGCAATGGTAAGAGGAAGAGTATCCCCAAAAGGATTGGGGTTTAACGGGTCCGATTTGCATGGGAGGAAATCCTTCCCCAAAATCAATTTCGCAAGCGCAAATTCAAAATCGAG...

CDS

Download CDS FASTA

1161 bp · LXL04_018780|LXL04_018780|OH1004|CDS

ATGCCACATGGCACCATCTTATTCAATCTCACAAATATTTTCCCGCCTAAACTCAATTACATGTTGTTTCCGATCGTTCATCATCAATCTCGATTTAACTCAACTGAAATAATGGCTTCTTCAATGCTGTATGGAGCTGAGAATCTCGCAATGGTAAGAGGAAGAGTATCCCCAAAAGGATTGGGGTTTAACGGGTCCGATTTGCATGGGAGGAAATCCTTCCCCAAAATCAATTTCGCAAGCGCAAATTCAAAATCGAG...

Protein

Download Protein FASTA

386 aa · LXL04_018780|LXL04_018780|OH1004|PROTEIN

MPHGTILFNLTNIFPPKLNYMLFPIVHHQSRFNSTEIMASSMLYGAENLAMVRGRVSPKGLGFNGSDLHGRKSFPKINFASANSKSRGNLRGISKTLIVPKCSVSVPRPASQPRFIQHKKEAFWFYRFLSIVYDHVINPGHWTEDMRDEALEPADLYSRNMIVVDVGGGTGFTTLGIVKHVDAKNVTILDQSPHQLAKAKQKEPLKECKIIEGDAEDLPFKTDYADRYISAGSIEYWPDPQRGIKEAYRVLKIGGKACLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018780`
TK1151 ID	TkA08G082720
OH-1004 ID	LXL04_018780
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 90.415 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018780

Location Chr04:18136391-18140023 (-)

Description Similar to 2-methyl-6-phytyl-1,4-hydroquinone methyltransferase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g63410`	Involved in a key methylation step in both tocopherols (vitamin E) and plastoquinone synthesis.	Highly divergent methyltransferases catalyze a conserved reaction in tocopherol and plastoquinone synthesis in cyanobacteria and photosynthetic eukaryotes.2003 · DOI: 10.1105/tpc.013656

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0179300`	Involved in a key methylation step in both tocopherols (vitamin E) and plastoquinone synthesis.	No verified direct reference in this release
`Os12g0615400`	Involved in a key methylation step in both tocopherols (vitamin E) and plastoquinone synthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018780 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009060 aerobic respiration Biological Process

GO:0009234 menaquinone biosynthetic process Biological Process

GO:0010189 vitamin E biosynthetic process Biological Process

GO:0010236 plastoquinone biosynthetic process Biological Process

GO:0032259 methylation Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0008425 2-methoxy-6-polyprenyl-1,4-benzoquinol methyltransferase activity Molecular Function

GO:0008757 S-adenosylmethionine-dependent methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G63410

dosa:Os12g0615400

rhi:NGR_c37130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.975

Rank 1 · LXL04_018780 · OH-1004

Mitochondrion0.028

Rank 2 · LXL04_018780 · OH-1004

Cytoplasm0.013

Rank 3 · LXL04_018780 · OH-1004

Cell membrane0.013

Rank 4 · LXL04_018780 · OH-1004

Nucleus0.012

Rank 5 · LXL04_018780 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13847.13Methyltransf_31159-262 aa

PF01209.25Ubie_methyltran160-260 aa

PF13649.13Methyltransf_25163-255 aa

PF08241.19Methyltransf_11164-258 aa

PF08242.19Methyltransf_12164-256 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018780	`PF13847.13`	Methyltransf_31	159	262	1.5e-12	48.3
LXL04_018780	`PF01209.25`	Ubie_methyltran	160	260	2e-14	54.3
LXL04_018780	`PF13649.13`	Methyltransf_25	163	255	6.9e-17	62.6
LXL04_018780	`PF08241.19`	Methyltransf_11	164	258	2.3e-19	70.6
LXL04_018780	`PF08242.19`	Methyltransf_12	164	256	3.1e-10	41.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LY74`	Arabidopsis thaliana	2-methyl-6-phytyl-1,4-hydroquinone methyltransferase, chloroplastic	75.429%	Swiss-Prot	strong database homology
`Q6ZLD3`	Oryza sativa subsp. japonica	2-methyl-6-phytyl-1,4-hydroquinone methyltransferase 1, chloroplastic	74.242%	Swiss-Prot	strong database homology
`Q2QM69`	Oryza sativa subsp. japonica	2-methyl-6-phytyl-1,4-hydroquinone methyltransferase 2, chloroplastic	70.286%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card