LXL04_018778 | RubberDandelionOmics

Gene overview

LXL04_018778

Reference: OH-1004 Chr: Chr04 Coordinates: 18120444-18121759 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

360 bp · LXL04_018778|LXL04_018778|OH1004|cDNA

ATGGGTTACTCTATGGCTACAATGACAAGTGCAAATCAATGGAGTGTTGGATGTACTGTTATTGAGATGGCAACTGGAAAGCCTCCATGGAGCCAACAATATCAGGTGATGTTTTGTTTAGGTTGCTGCTCTTTTTCATATAGGAACCGAACAACAAAAGCACATCCACCTATACCATACCATCTTTCCATGCCTCTAAAAAGAAGAAACTGGTGCATTGGATGCTTCAAGtGTTCAAGTTTTGAACATAATCTCCGTTT...

CDS

Download CDS FASTA

360 bp · LXL04_018778|LXL04_018778|OH1004|CDS

ATGGGTTACTCTATGGCTACAATGACAAGTGCAAATCAATGGAGTGTTGGATGTACTGTTATTGAGATGGCAACTGGAAAGCCTCCATGGAGCCAACAATATCAGGTGATGTTTTGTTTAGGTTGCTGCTCTTTTTCATATAGGAACCGAACAACAAAAGCACATCCACCTATACCATACCATCTTTCCATGCCTCTAAAAAGAAGAAACTGGTGCATTGGATGCTTCAAGTGTTCAAGTTTTGAACATAATCTCCGTTT...

Protein

Download Protein FASTA

119 aa · LXL04_018778|LXL04_018778|OH1004|PROTEIN

MGYSMATMTSANQWSVGCTVIEMATGKPPWSQQYQVMFCLGCCSFSYRNRTTKAHPPIPYHLSMPLKRRNWCIGCFKCSSFEHNLRFEAYVGDIIPYALELIQLLIVKSIYKVFCKFSF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018778`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018778

Location Chr04:18120444-18121759 (-)

Description Similar to NPK1: Mitogen-activated protein kinase kinase kinase NPK1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06030`	Involved in cortical microtubules organization and stabilization by regulating the phosphorylation state of microtubule- associated proteins such as MAP65-1.	Arabidopsis homologs of nucleus- and phragmoplast-localized kinase 2 and 3 and mitogen-activated protein kinase 4 are essential for microtubule organization.2010 · DOI: 10.1105/tpc.109.071746
`At1g54960`	Involved in cortical microtubules organization and stabilization by regulating the phosphorylation state of microtubule- associated proteins such as MAP65-1.	Arabidopsis homologs of nucleus- and phragmoplast-localized kinase 2 and 3 and mitogen-activated protein kinase 4 are essential for microtubule organization.2010 · DOI: 10.1105/tpc.109.071746
`At1g09000`	May be involved in an oxidative stress-mediated signaling cascade that phosphorylates downstream MAP kinases MPK3 and MPK6.	Functional analysis of oxidative stress-activated mitogen-activated protein kinase cascade in plants.2000 · DOI: 10.1073/pnas.97.6.2940 An Arabidopsis mitogen-activated protein kinase kinase kinase gene family encodes essential positive regulators of cytokinesis.2002 · DOI: 10.1105/tpc.001164

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018778 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000165 MAPK cascade Biological Process

GO:0000919 cell plate assembly Biological Process

GO:0006935 chemotaxis Biological Process

GO:0006952 defense response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0007254 JNK cascade Biological Process

GO:0008340 determination of adult lifespan Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0038066 p38MAPK cascade Biological Process

GO:0042594 response to starvation Biological Process

GO:0043622 cortical microtubule organization Biological Process

KEGG gene cross-reference

ath:AT1G09000

ath:AT1G54960

ath:AT3G06030

cel:CELE_F59A6.1

nta:107796336

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.426

Rank 1 · LXL04_018778 · OH-1004

Nucleus0.415

Rank 2 · LXL04_018778 · OH-1004

Mitochondrion0.162

Rank 3 · LXL04_018778 · OH-1004

Endoplasmic reticulum0.080

Rank 4 · LXL04_018778 · OH-1004

Cell membrane0.075

Rank 5 · LXL04_018778 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22042`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase 3	51.250%	Swiss-Prot	moderate database homology
`Q9FZ36`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase 2	43.299%	Swiss-Prot	moderate database homology
`O22040`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase ANP1	55.738%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card