LXL04_018732 | RubberDandelionOmics

Gene overview

LXL04_018732

Reference: OH-1004 Chr: Chr04 Coordinates: 17341998-17342508 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

372 bp · LXL04_018732|LXL04_018732|OH1004|cDNA

ATGACTTTACTCGAAGAAGAGAGCTTGAAACTTACCGAAGTTCAAAGGCTCGAAGGTCATACTGATAGGGTATGGGGTCTAGCTTGGAATCCGGCTACCGGTGCTGACGGTGTACCTGCTATCCTCGCTTCTTGTAGCGGCGAAAAGACTGTTCGAATCTGGCAACAACGTAGCCCTTCATCTACATCCTTTGATTGCAAGGCAGTATTAGAAGACAAACATACTCGAACAGTTCGATCGTGTTCCTGGTCACCTTCCGG...

CDS

Download CDS FASTA

372 bp · LXL04_018732|LXL04_018732|OH1004|CDS

ATGACTTTACTCGAAGAAGAGAGCTTGAAACTTACCGAAGTTCAAAGGCTCGAAGGTCATACTGATAGGGTATGGGGTCTAGCTTGGAATCCGGCTACCGGTGCTGACGGTGTACCTGCTATCCTCGCTTCTTGTAGCGGCGAAAAGACTGTTCGAATCTGGCAACAACGTAGCCCTTCATCTACATCCTTTGATTGCAAGGCAGTATTAGAAGACAAACATACTCGAACAGTTCGATCGTGTTCCTGGTCACCTTCCGG...

Protein

Download Protein FASTA

123 aa · LXL04_018732|LXL04_018732|OH1004|PROTEIN

MTLLEEESLKLTEVQRLEGHTDRVWGLAWNPATGADGVPAILASCSGEKTVRIWQQRSPSSTSFDCKAVLEDKHTRTVRSCSWSPSGKQLATTSFDATTTIWEQNGTDFECVSTLEVLQQTSF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018732`
TK1151 ID	TkA05G395010
OH-1004 ID	LXL04_018732
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.200
Protein coverage (%)	TK1151 41.212 / OH-1004 55.285 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018732

Location Chr04:17341998-17342508 (+)

Description Similar to CIA1: Protein CIA1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26060`	Essential component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018732 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0051604 protein maturation Biological Process

GO:0005634 nucleus Cellular Component

GO:0097361 cytosolic [4Fe-4S] assembly targeting complex Cellular Component

KEGG gene cross-reference

ath:AT2G26060

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.579

Rank 1 · LXL04_018732 · OH-1004

Nucleus0.492

Rank 2 · LXL04_018732 · OH-1004

Cell membrane0.081

Rank 3 · LXL04_018732 · OH-1004

Endoplasmic reticulum0.059

Rank 4 · LXL04_018732 · OH-1004

Golgi apparatus0.052

Rank 5 · LXL04_018732 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25174.2Beta-prop_THOC310-62 aa

PF23381.2Beta-prop_IFT122_1st12-109 aa

PF25175.2Beta-prop_WDR512-115 aa

PF25173.2Beta-prop_WDR3_1st12-103 aa

PF00400.39WD4013-54 aa

PF24807.2WD40_CDC20-Fz13-117 aa

PF24814.2WD40_Prp1914-105 aa

PF25047.1Beta-prop_TEP1_2nd15-104 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018732	`PF25174.2`	Beta-prop_THOC3	10	62	6.6e-16	58.8
LXL04_018732	`PF23381.2`	Beta-prop_IFT122_1st	12	109	3.6e-14	53.5
LXL04_018732	`PF25175.2`	Beta-prop_WDR5	12	115	2e-13	51.0
LXL04_018732	`PF25173.2`	Beta-prop_WDR3_1st	12	103	3.4e-10	40.6
LXL04_018732	`PF00400.39`	WD40	13	54	2.2e-15	57.1
LXL04_018732	`PF24807.2`	WD40_CDC20-Fz	13	117	9.6e-11	42.2
LXL04_018732	`PF24814.2`	WD40_Prp19	14	105	9.4e-10	38.7
LXL04_018732	`PF25047.1`	Beta-prop_TEP1_2nd	15	104	3.8e-08	33.5
LXL04_018732	`PF25460.2`	Beta-prop_Aladin	23	105	5.8e-06	26.4
LXL04_018732	`PF24105.2`	Beta-prop_CAF1B_HIR1	42	108	3.4e-09	36.9
LXL04_018732	`PF24817.2`	WD40_WDHD1_1st	63	105	2e-08	34.5
LXL04_018732	`PF00400.39`	WD40	67	102	2.2e-15	57.1
LXL04_018732	`PF25174.2`	Beta-prop_THOC3	74	108	6.6e-16	58.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80990`	Arabidopsis thaliana	Protein CIA1	65.789%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card