Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1173 bp · LXL04_018497|LXL04_018497|OH1004|cDNA
ATGGTGTTTAATTTCATATGTCGAAGATTCTTAATCCATGCGAGGCCTCAGATCAAGCACGAACTGCAATTCAACTTCTTCCTATTCTGTTCATCGTCCCAATCGTCCCCATTTACAACCAAAACATCAGGTTCCTCGCATCAACACTCATTTACAGTCACTTACCTCATTAATTCATGTGGGATTTCTCCCGAATCTGCAATTCTAGCTTCCAATCGTCTAGATTTATCCAAATCCCCAAACACAGCAGACTCTGTTCT...
1173 bp · LXL04_018497|LXL04_018497|OH1004|CDS
ATGGTGTTTAATTTCATATGTCGAAGATTCTTAATCCATGCGAGGCCTCAGATCAAGCACGAACTGCAATTCAACTTCTTCCTATTCTGTTCATCGTCCCAATCGTCCCCATTTACAACCAAAACATCAGGTTCCTCGCATCAACACTCATTTACAGTCACTTACCTCATTAATTCATGTGGGATTTCTCCCGAATCTGCAATTCTAGCTTCCAATCGTCTAGATTTATCCAAATCCCCAAACACAGCAGACTCTGTTCT...
Protein
Download Protein FASTA390 aa · LXL04_018497|LXL04_018497|OH1004|PROTEIN
MVFNFICRRFLIHARPQIKHELQFNFFLFCSSSQSSPFTTKTSGSSHQHSFTVTYLINSCGISPESAILASNRLDLSKSPNTADSVLSFLNNHDFTKSQVSKLISMHPRLLLSDPETTLLPNFQTLNSLGISNTDIAAIVTARPKEILTKKLQDTAVPCFNYLKTVLSSHDKVISCIKRFPTALTYDLQIYAAENIRLLLEIGVPKLRIESMLAQQPRTFFTSADRFKKVVEVVTEMGFDPSKIRFLLAIHAVRAMSKST...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_018497 |
|---|---|
| TK1151 ID | TkA08G064660 |
| OH-1004 ID | LXL04_018497 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.500 |
| Protein coverage (%) | TK1151 99.483 / OH-1004 98.718Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_018497 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:13788654-13790541 (-) | |||||||||
| Description | Protein of unknown function | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006353 DNA-templated transcription termination Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006393 termination of mitochondrial transcription Biological Process GO:0006970 response to osmotic stress Biological Process GO:0008380 RNA splicing Biological Process GO:0009651 response to salt stress Biological Process GO:0009658 chloroplast organization Biological Process GO:0009737 response to abscisic acid Biological Process GO:0015979 photosynthesis Biological Process GO:0042254 ribosome biogenesis Biological Process GO:0042793 plastid transcription Biological Process GO:0005739 mitochondrion Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT4G14605 ath:AT5G54180 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02536.20mTERF87-247 aaPF02536.20mTERF194-365 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_018497 | PF02536.20 | mTERF | 87 | 247 | 1.6e-39 | 136.4 |
| LXL04_018497 | PF02536.20 | mTERF | 194 | 365 | 1.6e-39 | 136.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.