LXL04_018451 | RubberDandelionOmics

Gene overview

LXL04_018451

Reference: OH-1004 Chr: Chr04 Coordinates: 13142692-13146021 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

987 bp · LXL04_018451|LXL04_018451|OH1004|cDNA

ATGCCGACCGCACCACCAGGACGACCTCACCAGTACAGAAAACGCACTTTCCATGAGGAAGATGAAGAATCGGACGACTTCCTGTGGTGGAACAAAATGATCACCGGTTTTGGTCTTACAATCAGCAACAAATCAACAGAGTGGGGCATGCGGGTACACTTGATCCTATGGCAACTGGTTTGCTTATTGTCTGTATCGGGTATGGTTAAAGGATATAGTGGAGTTCTTCGATTAGGGGAAGCCACCTCAACTCTTGATGC...

CDS

Download CDS FASTA

987 bp · LXL04_018451|LXL04_018451|OH1004|CDS

ATGCCGACCGCACCACCAGGACGACCTCACCAGTACAGAAAACGCACTTTCCATGAGGAAGATGAAGAATCGGACGACTTCCTGTGGTGGAACAAAATGATCACCGGTTTTGGTCTTACAATCAGCAACAAATCAACAGAGTGGGGCATGCGGGTACACTTGATCCTATGGCAACTGGTTTGCTTATTGTCTGTATCGGGTATGGTTAAAGGATATAGTGGAGTTCTTCGATTAGGGGAAGCCACCTCAACTCTTGATGC...

Protein

Download Protein FASTA

328 aa · LXL04_018451|LXL04_018451|OH1004|PROTEIN

MPTAPPGRPHQYRKRTFHEEDEESDDFLWWNKMITGFGLTISNKSTEWGMRVHLILWQLVCLLSVSGMVKGYSGVLRLGEATSTLDADSPVIQREPWEHIKDDDIKKTAASFCGEIWQVPPMFSAIKVGGKRLDEKARRGENVELSPRRISIFQFDVERSLQDRLCIVKRRCFDPKSPPLHKLSSSEEIEDIEGFFPVSDSQKGTTEECYAIEDGTTPEISQITTNSSEGIEDIEGFFPVSDSQRGTTEEIGTDRFPRPH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018451`
TK1151 ID	TkA02G525510
OH-1004 ID	LXL04_018451
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	68.900
Protein coverage (%)	TK1151 97.541 / OH-1004 41.159 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_018451`
Location	Chr04:13142692-13146021 (+)
Description	Similar to truB: tRNA pseudouridine synthase B (Lactobacillus sakei subsp. sakei (strain 23K)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018451` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0031119 tRNA pseudouridine synthesis Biological Process GO:1990481 mRNA pseudouridine synthesis Biological Process GO:0003723 RNA binding Molecular Function GO:0160148 tRNA pseudouridine(55) synthase activity Molecular Function
KEGG gene cross-reference	fjo:Fjoh_0570 lsa:LCA_1242 mjl:Mjls_2078 mkm:Mkms_2141 mmc:Mmcs_2095 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.384

Rank 1 · LXL04_018451 · OH-1004

Nucleus0.372

Rank 2 · LXL04_018451 · OH-1004

Mitochondrion0.181

Rank 3 · LXL04_018451 · OH-1004

Cell membrane0.120

Rank 4 · LXL04_018451 · OH-1004

Endoplasmic reticulum0.083

Rank 5 · LXL04_018451 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01509.24TruB_N66-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018451	`PF01509.24`	TruB_N	66	160	2.6e-24	87.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card