LXL04_018211 | RubberDandelionOmics

Gene overview

LXL04_018211

Reference: OH-1004 Chr: Chr04 Coordinates: 8698435-8700264 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

750 bp · LXL04_018211|LXL04_018211|OH1004|cDNA

AGGTTCAACCTCTCCGTCTCCACCAAGGTATCCGAATCCCCCATCATCACATTTGAAGAATCATCGACCACTCTCTCACTCCCGACACCTCTTTCCTATGCGTGGGTGTTTCGATTTTTGAACCTCAGAGACACTAGAATGACTCTACTAAGACCAGTCGCGGAAGATGTGACAATTCTTGATGTGCAACAACAAGAGATCAAGGCTAGAATATCACAGTTAAATGCGGAGATATCAGAGTTCAATGAATCAAGAGAAAA...

CDS

Download CDS FASTA

633 bp · LXL04_018211|LXL04_018211|OH1004|CDS

TTGAACCTCAGAGACACTAGAATGACTCTACTAAGACCAGTCGCGGAAGATGTGACAATTCTTGATGTGCAACAACAAGAGATCAAGGCTAGAATATCACAGTTAAATGCGGAGATATCAGAGTTCAATGAATCAAGAGAAAAGGAGTTGCCTTTAATTCAAGAAGTTGACATCAAAATTAAAGAACTTCGCAAGATGATTTCAGCCCTAAATAACCAGCAAATGTCCCTAAAGGCTGCATTTAGAAAAAAGAAGGATGC...

Protein

Download Protein FASTA

210 aa · LXL04_018211|LXL04_018211|OH1004|PROTEIN

MNLRDTRMTLLRPVAEDVTILDVQQQEIKARISQLNAEISEFNESREKELPLIQEVDIKIKELRKMISALNNQQMSLKAAFRKKKDAVKEIDEKISSAEFALVQSAQENASLRSKIVQSPDKLQRALEEKKAVLIESKNAKRESMQSFHEKAAILEVYAKGSKKMSKHLKQMQSLQEQVNSAKQVEKDVKFLKVKNNGHCYRFANYRVTG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018211`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018211

Location Chr04:8698435-8700264 (+)

Description Similar to NUF2: Kinetochore protein NUF2 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61000`	Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity to ensure proper cell division.	MUN (MERISTEM UNSTRUCTURED), encoding a SPC24 homolog of NDC80 kinetochore complex, affects development through cell division in Arabidopsis thaliana.2018 · DOI: 10.1111/tpj.13823

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018211 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000070 mitotic sister chromatid segregation Biological Process

GO:0007052 mitotic spindle organization Biological Process

GO:0010342 endosperm cellularization Biological Process

GO:0045132 meiotic chromosome segregation Biological Process

GO:0051301 cell division Biological Process

GO:0051315 attachment of mitotic spindle microtubules to kinetochore Biological Process

GO:0051383 kinetochore organization Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005828 kinetochore microtubule Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0031262 Ndc80 complex Cellular Component

KEGG gene cross-reference

ath:AT1G61000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.590

Rank 1 · LXL04_018211 · OH-1004

Nucleus0.337

Rank 2 · LXL04_018211 · OH-1004

Mitochondrion0.048

Rank 3 · LXL04_018211 · OH-1004

Cell membrane0.039

Rank 4 · LXL04_018211 · OH-1004

Golgi apparatus0.033

Rank 5 · LXL04_018211 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXJ0`	Arabidopsis thaliana	Kinetochore protein NUF2 homolog	52.239%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card