LXL04_017378 | RubberDandelionOmics

Gene overview

LXL04_017378

Reference: OH-1004 Chr: Chr03 Coordinates: 147871435-147873873 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1099 bp · LXL04_017378|LXL04_017378|OH1004|cDNA

ATGGCGCTTGCTCAAGTTTCTTCGTCACCGTGTATCTCCACCGCCGCTAGATTGTCCGGCGTTCCACAGTTCTCATCATCCAGTTTGCCTCGAATTGGAACAAGCTTTACTTGCGGTTCACCCCTAGTGATATGCAGAACTCATCACCAGAAGGCGATCGTACCTAAATCAAAAGCATTTTCAGTGAGATGTGAACAAAGCAGTAAAGATGGAAACAGTTTAGACGTGTGGCTAGGTCGCACAGCAATGGTGGGATTTGC...

CDS

Download CDS FASTA

1083 bp · LXL04_017378|LXL04_017378|OH1004|CDS

ATGGCGCTTGCTCAAGTTTCTTCGTCACCGTGTATCTCCACCGCCGCTAGATTGTCCGGCGTTCCACAGTTCTCATCATCCAGTTTGCCTCGAATTGGAACAAGCTTTACTTGCGGTTCACCCCTAGTGATATGCAGAACTCATCACCAGAAGGCGATCGTACCTAAATCAAAAGCATTTTCAGTGAGATGTGAACAAAGCAGTAAAGATGGAAACAGTTTAGACGTGTGGCTAGGTCGCACAGCAATGGTGGGATTTGC...

Protein

Download Protein FASTA

360 aa · LXL04_017378|LXL04_017378|OH1004|PROTEIN

MALAQVSSSPCISTAARLSGVPQFSSSSLPRIGTSFTCGSPLVICRTHHQKAIVPKSKAFSVRCEQSSKDGNSLDVWLGRTAMVGFAVAISVEVSTGKGLLENFGLTSPLPTVALAVTGLVGVLTAHNIVFSLCFIHVISCLKLVSHGWQWNSLYVLSCIYLYKSPYFDYKLNTNMGSRFSRVKQLIAKRDVKILMLGLDGSGKTTILYKLKLGDFVASVPTIGFNVEAVEYKNVRFTVWDLGGQDTIRPLWRHYYRNTH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017378`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017378

Location Chr03:147871435-147873873 (+)

Description Similar to ARF1: ADP-ribosylation factor 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0489600`	GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.	No verified direct reference in this release
`Os01g0813400`	GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017378 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0003924 GTPase activity Molecular Function

GO:0003925 G protein activity Molecular Function

GO:0005525 GTP binding Molecular Function

GO:0016004 phospholipase activator activity Molecular Function

KEGG gene cross-reference

dosa:Os01g0813400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.947

Rank 1 · LXL04_017378 · OH-1004

Mitochondrion0.050

Rank 2 · LXL04_017378 · OH-1004

Cytoplasm0.037

Rank 3 · LXL04_017378 · OH-1004

Nucleus0.030

Rank 4 · LXL04_017378 · OH-1004

Cell membrane0.022

Rank 5 · LXL04_017378 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00025.28Arf185-351 aa

PF09439.17SRPRB192-318 aa

PF08477.20Roc193-303 aa

PF00071.29Ras193-350 aa

PF04670.19Gtr1_RagA193-323 aa

PF00503.27G-alpha218-304 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017378	`PF00025.28`	Arf	185	351	6.5e-73	244.6
LXL04_017378	`PF09439.17`	SRPRB	192	318	2.5e-10	40.7
LXL04_017378	`PF08477.20`	Roc	193	303	1.1e-14	55.4
LXL04_017378	`PF00071.29`	Ras	193	350	7.2e-14	52.4
LXL04_017378	`PF04670.19`	Gtr1_RagA	193	323	2.3e-09	37.8
LXL04_017378	`PF00503.27`	G-alpha	218	304	2.2e-13	50.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P51823`	Oryza sativa subsp. japonica	ADP-ribosylation factor 2	66.111%	Swiss-Prot	weak database homology
`Q06396`	Oryza sativa subsp. japonica	ADP-ribosylation factor 1	66.111%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card