LXL04_016488 | RubberDandelionOmics

Gene overview

LXL04_016488

Reference: OH-1004 Chr: Chr03 Coordinates: 124738841-124743509 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1779 bp · LXL04_016488|LXL04_016488|OH1004|cDNA

ATGGAGCGAATGCTAAAAGCCGCCAGAGCGTCTGGCTCTCTCAATCTATCAAATCGCTCTCTCAAGGAAGTACCTGATGAGGTATACAAGAGTTTGGATGCAGTTGGTGAAGGTGAAAACTGGTGGGAGGCAGTTGAGTTACAAAAGCTGATATTAGCTCACAATGAAATTGAAATGCTAAAGGAAGACATAAGAAACTTACCAATGTTATCTGTACTAAATATCAGCCACAACAAGCTTTCCCACCTTCCAGCTGCCAT...

CDS

Download CDS FASTA

1779 bp · LXL04_016488|LXL04_016488|OH1004|CDS

ATGGAGCGAATGCTAAAAGCCGCCAGAGCGTCTGGCTCTCTCAATCTATCAAATCGCTCTCTCAAGGAAGTACCTGATGAGGTATACAAGAGTTTGGATGCAGTTGGTGAAGGTGAAAACTGGTGGGAGGCAGTTGAGTTACAAAAGCTGATATTAGCTCACAATGAAATTGAAATGCTAAAGGAAGACATAAGAAACTTACCAATGTTATCTGTACTAAATATCAGCCACAACAAGCTTTCCCACCTTCCAGCTGCCAT...

Protein

Download Protein FASTA

592 aa · LXL04_016488|LXL04_016488|OH1004|PROTEIN

MERMLKAARASGSLNLSNRSLKEVPDEVYKSLDAVGEGENWWEAVELQKLILAHNEIEMLKEDIRNLPMLSVLNISHNKLSHLPAAIGELKSLKALDVSSNLLREIPEEIGSVTSLIKFDCSSNQLKDLPCSLGDCQALSDLKASNNSLTSLPEDLSNCSKMLKLDLEGNKLTVLSDILVASWTSLTEINAGMSHTFFSSKNTLSGVPESIGGLSRLIRLDLHQNKISLIPSSIKGCSLLAEFYIGNNFLTSLPAEIGQL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016488`
TK1151 ID	TkA02G134750
OH-1004 ID	LXL04_016488
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016488

Location Chr03:124738841-124743509 (-)

Description Similar to IRL6: Plant intracellular Ras-group-related LRR protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0826600`	Leucine-rich repeat protein that likely mediates protein interactions, possibly in the context of signal transduction.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016488 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0035556 intracellular signal transduction Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

dosa:Os02g0826600

gga:424713

hsa:55631

xla:444098

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.682

Rank 1 · LXL04_016488 · OH-1004

Nucleus0.345

Rank 2 · LXL04_016488 · OH-1004

Cell membrane0.081

Rank 3 · LXL04_016488 · OH-1004

Golgi apparatus0.068

Rank 4 · LXL04_016488 · OH-1004

Endoplasmic reticulum0.044

Rank 5 · LXL04_016488 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_1444-119 aa

PF13855.13LRR_846-103 aa

PF23211.1LRR_LRWD173-129 aa

PF23598.2LRR_14204-267 aa

PF13855.13LRR_8240-295 aa

PF23598.2LRR_14250-313 aa

PF13855.13LRR_8262-318 aa

PF12799.14LRR_4285-321 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016488	`PF23598.2`	LRR_14	44	119	1.9e-30	106.5
LXL04_016488	`PF13855.13`	LRR_8	46	103	5.6e-49	164.5
LXL04_016488	`PF23211.1`	LRR_LRWD1	73	129	2.5e-09	37.8
LXL04_016488	`PF23598.2`	LRR_14	204	267	1.9e-30	106.5
LXL04_016488	`PF13855.13`	LRR_8	240	295	5.6e-49	164.5
LXL04_016488	`PF23598.2`	LRR_14	250	313	1.9e-30	106.5
LXL04_016488	`PF13855.13`	LRR_8	262	318	5.6e-49	164.5
LXL04_016488	`PF12799.14`	LRR_4	285	321	1.2e-39	134.1
LXL04_016488	`PF13855.13`	LRR_8	369	424	5.6e-49	164.5
LXL04_016488	`PF23598.2`	LRR_14	395	468	1.9e-30	106.5
LXL04_016488	`PF12799.14`	LRR_4	414	452	1.2e-39	134.1
LXL04_016488	`PF13855.13`	LRR_8	437	493	5.6e-49	164.5
LXL04_016488	`PF23598.2`	LRR_14	462	560	1.9e-30	106.5
LXL04_016488	`PF13855.13`	LRR_8	485	542	5.6e-49	164.5
LXL04_016488	`PF12799.14`	LRR_4	485	522	1.2e-39	134.1
LXL04_016488	`PF13855.13`	LRR_8	507	566	5.6e-49	164.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6K7R2`	Oryza sativa subsp. japonica	Plant intracellular Ras-group-related LRR protein 6	62.963%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card