LXL04_016440 | RubberDandelionOmics

Gene overview

LXL04_016440

Reference: OH-1004 Chr: Chr03 Coordinates: 123455018-123459248 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2100 bp · LXL04_016440|LXL04_016440|OH1004|cDNA

ATGGGTGATTTATCAAGGGAGGATCACAGCAACACAGTTCGTGTACTTGTTGCCACAGATTGTCATTTGGGATATATGGAAAAAGATGAAGTTCGTAGGCATGACTCATTTCAAGCATTTGAAGAGATATGCTCAATAGCAGAACAAAAGAAGGTGGACTTTGTACTCTTTGGTGGTGATCTTTTTCATGAAAACAAACCATCAAGAACAACATTAGTGAAAACAATAGAGATTTTGAGAAGATATTGTCTTAATGATAA...

CDS

Download CDS FASTA

2100 bp · LXL04_016440|LXL04_016440|OH1004|CDS

ATGGGTGATTTATCAAGGGAGGATCACAGCAACACAGTTCGTGTACTTGTTGCCACAGATTGTCATTTGGGATATATGGAAAAAGATGAAGTTCGTAGGCATGACTCATTTCAAGCATTTGAAGAGATATGCTCAATAGCAGAACAAAAGAAGGTGGACTTTGTACTCTTTGGTGGTGATCTTTTTCATGAAAACAAACCATCAAGAACAACATTAGTGAAAACAATAGAGATTTTGAGAAGATATTGTCTTAATGATAA...

Protein

Download Protein FASTA

699 aa · LXL04_016440|LXL04_016440|OH1004|PROTEIN

MGDLSREDHSNTVRVLVATDCHLGYMEKDEVRRHDSFQAFEEICSIAEQKKVDFVLFGGDLFHENKPSRTTLVKTIEILRRYCLNDKPVQFQVVSDQTINFANVFGHVNYEDPHFNVGLPVFSIHGNHDDPAGVDNLSAVDILSACNLVNYFGKMVLGGSGVGQITLYPILIKKGSTSVALYGLGNIRDERLNRMFQTPHAVQWMRPEAQESCQVSDWFNILVLHQNRVKTNPKNAINEHFLPRFLDFIVWGHEHECLVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016440`
TK1151 ID	TkA02G140830
OH-1004 ID	LXL04_016440
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016440

Location Chr03:123455018-123459248 (+)

Description Similar to MRE11: Double-strand break repair protein MRE11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54260`	Core component of the MRN complex, which plays a central role in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity and meiosis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0635900`	Core component of the MRN complex, which plays a central role in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity and meiosis.	No verified direct reference in this release
`UniProt: Q25AA3`	Core component of the MRN complex, which plays a central role in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity and meiosis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016440 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000019 regulation of mitotic recombination Biological Process

GO:0000723 telomere maintenance Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0000729 DNA double-strand break processing Biological Process

GO:0006281 DNA repair Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining Biological Process

GO:0006310 DNA recombination Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007004 telomere maintenance via telomerase Biological Process

GO:0007062 sister chromatid cohesion Biological Process

GO:0007095 mitotic G2 DNA damage checkpoint signaling Biological Process

KEGG gene cross-reference

ath:AT5G54260

dosa:Os04g0635900

hsa:4361

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.944

Rank 1 · LXL04_016440 · OH-1004

Cytoplasm0.154

Rank 2 · LXL04_016440 · OH-1004

Mitochondrion0.028

Rank 3 · LXL04_016440 · OH-1004

Cell membrane0.019

Rank 4 · LXL04_016440 · OH-1004

Endoplasmic reticulum0.009

Rank 5 · LXL04_016440 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00149.34Metallophos14-257 aa

PF04152.20Mre11_DNA_bind303-455 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016440	`PF00149.34`	Metallophos	14	257	2.7e-16	61.3
LXL04_016440	`PF04152.20`	Mre11_DNA_bind	303	455	6.1e-35	121.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XGM2`	Arabidopsis thaliana	Double-strand break repair protein MRE11	70.000%	Swiss-Prot	strong database homology
`Q7XQR9`	Oryza sativa subsp. japonica	Double-strand break repair protein MRE11	65.659%	Swiss-Prot	strong database homology
`Q25AA3`	Oryza sativa subsp. indica	Double-strand break repair protein MRE11	65.659%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card