Gene Card
Gene overview
cDNA / CDS / Protein Sequences
567 bp · LXL04_015498|LXL04_015498|OH1004|cDNA
ATGGGAAAAGGGAGACATTTAGCTTATGAGGTGAAAAGCGGAGTAGATTTCGACATGAAAATTGATATTCCCGTGAAATTGCTGTACCCATTTGGATTCTTTGAGGGAGACAATCCAAAACCTCAAATCGGGATCCTTGTGGGGAAGACGATGGTGAATTCGTCCTCCGATGCCCAAATCGGAGACCTAAACACAAAACAAGGGTGCACGTGGACTGAATTGGTGGTAGCAGCTGACTTGGCGGTGATGGTGGAGTTCTG...
567 bp · LXL04_015498|LXL04_015498|OH1004|CDS
ATGGGAAAAGGGAGACATTTAGCTTATGAGGTGAAAAGCGGAGTAGATTTCGACATGAAAATTGATATTCCCGTGAAATTGCTGTACCCATTTGGATTCTTTGAGGGAGACAATCCAAAACCTCAAATCGGGATCCTTGTGGGGAAGACGATGGTGAATTCGTCCTCCGATGCCCAAATCGGAGACCTAAACACAAAACAAGGGTGCACGTGGACTGAATTGGTGGTAGCAGCTGACTTGGCGGTGATGGTGGAGTTCTG...
Protein
Download Protein FASTA188 aa · LXL04_015498|LXL04_015498|OH1004|PROTEIN
MGKGRHLAYEVKSGVDFDMKIDIPVKLLYPFGFFEGDNPKPQIGILVGKTMVNSSSDAQIGDLNTKQGCTWTELVVAADLAVMVEFWTGSSFILAFRFGFPICKSRRMDQKGASKNFMAFGGGMRFCVGTDFTKVQMAVFLHCLVTKYGWQMVRGGEIVRIPGLQFPKGFHVEFTEKGKQNQDSETNP
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_015498 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_015498 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:73807487-73808600 (-) | ||||||||||||
| Description | Similar to CYP87A3: Cytochrome P450 87A3 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006694 steroid biosynthetic process Biological Process GO:0008203 cholesterol metabolic process Biological Process GO:0010268 brassinosteroid homeostasis Biological Process GO:0016125 sterol metabolic process Biological Process GO:0016132 brassinosteroid biosynthetic process Biological Process GO:0048364 root development Biological Process GO:0080003 thalianol metabolic process Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0009507 chloroplast Cellular Component GO:0016020 membrane Cellular Component GO:0030659 cytoplasmic vesicle membrane Cellular Component GO:0004497 monooxygenase activity Molecular Function | ||||||||||||
| KEGG gene cross-reference | ag:AEM42986 ag:AHF22090 ath:AT5G48000 dosa:Os04g0570000 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00067.28p450111-162 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_015498 | PF00067.28 | p450 | 111 | 162 | 7.4e-09 | 35.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.