Gene Card
Gene overview
cDNA / CDS / Protein Sequences
4068 bp · LXL04_015118|LXL04_015118|OH1004|cDNA
ATGGGCGTGCCGGCGTTTTACCGGTGGTTAGCAGAGAAGTATCCAATGGTGATAGTGGATGTTATAGAGGAAGAACCGGCTGTAATCGGCGGTGTTAAAATTCCGGTGGATACAAGCAAACCTAACCCTAATAAAATCGAGTATGATAACATGTATCTCGATATGAATGGGATTATTCACCCCTGTTTTCACCCTGAAGACCGGCCTTCTCCAACCTCTTTTAGTGAGGTGTTTCAATGCGTGTTTGACTATATTGACCG...
4068 bp · LXL04_015118|LXL04_015118|OH1004|CDS
ATGGGCGTGCCGGCGTTTTACCGGTGGTTAGCAGAGAAGTATCCAATGGTGATAGTGGATGTTATAGAGGAAGAACCGGCTGTAATCGGCGGTGTTAAAATTCCGGTGGATACAAGCAAACCTAACCCTAATAAAATCGAGTATGATAACATGTATCTCGATATGAATGGGATTATTCACCCCTGTTTTCACCCTGAAGACCGGCCTTCTCCAACCTCTTTTAGTGAGGTGTTTCAATGCGTGTTTGACTATATTGACCG...
Protein
Download Protein FASTA1355 aa · LXL04_015118|LXL04_015118|OH1004|PROTEIN
MGVPAFYRWLAEKYPMVIVDVIEEEPAVIGGVKIPVDTSKPNPNKIEYDNMYLDMNGIIHPCFHPEDRPSPTSFSEVFQCVFDYIDRLFVMVRPRKLLYMAIDGVAPRAKMNQQRARRFKAAKDAAEAAAEEERLREEFEKEGRTLPPKKESQTFDSNVITPGTEFMAVLSVALQYYIHKRLNSDPGWKSIKVILSDANVPGEGEHKIMSYIRLQRNLPSFDPNTRHCLYGLDADLIMLGLATHEVHFSILREVVFIKGE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_015118 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_015118 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:64186108-64193138 (-) | |||||||||
| Description | Similar to XRN3: 5'-3' exoribonuclease 3 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000956 nuclear-transcribed mRNA catabolic process Biological Process GO:0000967 rRNA 5'-end processing Biological Process GO:0006353 DNA-templated transcription termination Biological Process GO:0006364 rRNA processing Biological Process GO:0006369 termination of RNA polymerase II transcription Biological Process GO:0006397 mRNA processing Biological Process GO:0007283 spermatogenesis Biological Process GO:0010587 miRNA catabolic process Biological Process GO:0040034 regulation of development, heterochronic Biological Process GO:0051984 positive regulation of chromosome segregation Biological Process GO:0060149 negative regulation of post-transcriptional gene silencing Biological Process GO:0060965 negative regulation of miRNA-mediated gene silencing Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G75660 ath:AT5G42540 cel:CELE_Y48B6A.3 gga:421236 ncr:NCU01643 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03159.25XRN_N1-253 aaPF17846.7XRN_M325-819 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_015118 | PF03159.25 | XRN_N | 1 | 253 | 7.4e-103 | 343.9 |
| LXL04_015118 | PF17846.7 | XRN_M | 325 | 819 | 8.7e-165 | 549.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.