LXL04_014394 | RubberDandelionOmics

Gene overview

LXL04_014394

Reference: OH-1004 Chr: Chr03 Coordinates: 48176182-48177145 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

492 bp · LXL04_014394|LXL04_014394|OH1004|cDNA

ATGCCGAATGCGGAAGGAGGTCCACCGGAGGTGACCATGGAGACATCGATGGGCTCTTTCACCGTCGAGATGTACGACAAACACGCGCCTAAAACTTGCAAAAACTTCATTGAGCTATCTCGAAGGGGTTACTACAACAACGTTAAATTCCACAGAATCATCAAGGATTTCATAATTCAAGGGGGCGATCCCACTGGCACAGGAAGAGGTGGAGAATCCATTTACGGGTCAAAGTTTGAAGATGAGATCACCCGAAGTCT...

CDS

Download CDS FASTA

492 bp · LXL04_014394|LXL04_014394|OH1004|CDS

ATGCCGAATGCGGAAGGAGGTCCACCGGAGGTGACCATGGAGACATCGATGGGCTCTTTCACCGTCGAGATGTACGACAAACACGCGCCTAAAACTTGCAAAAACTTCATTGAGCTATCTCGAAGGGGTTACTACAACAACGTTAAATTCCACAGAATCATCAAGGATTTCATAATTCAAGGGGGCGATCCCACTGGCACAGGAAGAGGTGGAGAATCCATTTACGGGTCAAAGTTTGAAGATGAGATCACCCGAAGTCT...

Protein

Download Protein FASTA

163 aa · LXL04_014394|LXL04_014394|OH1004|PROTEIN

MPNAEGGPPEVTMETSMGSFTVEMYDKHAPKTCKNFIELSRRGYYNNVKFHRIIKDFIIQGGDPTGTGRGGESIYGSKFEDEITRSLKHTGAGIISMANAGPNTNGSQFFITLAPAQSLDGKHTIFGRVCRGMEIVKRLGSVQTDNTDRPVHDVKILRTSVKD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014394`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014394

Location Chr03:48176182-48177145 (-)

Description Similar to CYP18-2: Peptidyl-prolyl cis-trans isomerase CYP18-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36130`	PPIases accelerate the folding of proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014394 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0000413 protein peptidyl-prolyl isomerization Biological Process

GO:0006457 protein folding Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005681 spliceosomal complex Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0071006 U2-type catalytic step 1 spliceosome Cellular Component

GO:0071007 U2-type catalytic step 2 spliceosome Cellular Component

KEGG gene cross-reference

ath:AT2G36130

bta:508179

hsa:51645

mmu:68816

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.640

Rank 1 · LXL04_014394 · OH-1004

Nucleus0.376

Rank 2 · LXL04_014394 · OH-1004

Mitochondrion0.124

Rank 3 · LXL04_014394 · OH-1004

Cell membrane0.077

Rank 4 · LXL04_014394 · OH-1004

Endoplasmic reticulum0.067

Rank 5 · LXL04_014394 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00160.27Pro_isomerase11-161 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014394	`PF00160.27`	Pro_isomerase	11	161	4.1e-56	190.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIH1`	Arabidopsis thaliana	Peptidyl-prolyl cis-trans isomerase CYP18-2	84.906%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card