LXL04_013829 | RubberDandelionOmics

Gene overview

LXL04_013829

Reference: OH-1004 Chr: Chr03 Coordinates: 36587267-36588395 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

846 bp · LXL04_013829|LXL04_013829|OH1004|cDNA

ATGGGCAAAGTGTCCCCTAAAGAGAAAATGTCCAAGACATCAAAGCAAAAGAGGCGTAACAATGGTTCTAATAAGTACTTGAAGCCAGGTGCTCTTGCACAGCTCCGTAATAGCAAAGCCTCAGCATCCAAGCCAAACACAGACATTGGGATGAAAAATGCTGATGTTATGGATGCAGAGAAGACTCATGATGATACTCCTTCTCAGAGTAAACATGCAAATGATACGCCTATAATTTTATCACCTGAAAAATTCAGATT...

CDS

Download CDS FASTA

846 bp · LXL04_013829|LXL04_013829|OH1004|CDS

ATGGGCAAAGTGTCCCCTAAAGAGAAAATGTCCAAGACATCAAAGCAAAAGAGGCGTAACAATGGTTCTAATAAGTACTTGAAGCCAGGTGCTCTTGCACAGCTCCGTAATAGCAAAGCCTCAGCATCCAAGCCAAACACAGACATTGGGATGAAAAATGCTGATGTTATGGATGCAGAGAAGACTCATGATGATACTCCTTCTCAGAGTAAACATGCAAATGATACGCCTATAATTTTATCACCTGAAAAATTCAGATT...

Protein

Download Protein FASTA

281 aa · LXL04_013829|LXL04_013829|OH1004|PROTEIN

MGKVSPKEKMSKTSKQKRRNNGSNKYLKPGALAQLRNSKASASKPNTDIGMKNADVMDAEKTHDDTPSQSKHANDTPIILSPEKFRFNNVAGQVDLVKENNLQRTPKTPRPEGIISDSDSRLESLPMELLVKILCHLHHDQLRAVFHVSERVRKAVVIARQFHFNYKTPDRSRQEMLCTSTPLPTEHWPFVSKGDGKSKVLTLPNTPKAPRHGPRPPSRLKITEMRQIAAVLFQESAFRPPRYIVPSLLPKPICKSFASN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013829`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013829

Location Chr03:36587267-36588395 (-)

Description Similar to At4g35930: F-box protein At4g35930

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35930`	F-box protein At4g35930.	No verified direct reference in this release
`At1g61340`	F-box protein At1g61340.	No verified direct reference in this release
`At4g21510`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At4g05010`	F-box protein At4g05010.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013829 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009611 response to wounding Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009961 response to 1-aminocyclopropane-1-carboxylic acid Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G61340

ath:AT4G05010

ath:AT4G21510

ath:AT4G35930

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.827

Rank 1 · LXL04_013829 · OH-1004

Cytoplasm0.237

Rank 2 · LXL04_013829 · OH-1004

Mitochondrion0.041

Rank 3 · LXL04_013829 · OH-1004

Cell membrane0.031

Rank 4 · LXL04_013829 · OH-1004

Endoplasmic reticulum0.014

Rank 5 · LXL04_013829 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5XF11`	Arabidopsis thaliana	F-box protein At4g35930	48.000%	Swiss-Prot	moderate database homology
`Q8GX77`	Arabidopsis thaliana	F-box protein At1g61340	44.068%	Swiss-Prot	weak database homology
`O65416`	Arabidopsis thaliana	F-box protein SKIP27	40.741%	Swiss-Prot	weak database homology
`Q9S9T6`	Arabidopsis thaliana	F-box protein At4g05010	39.394%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card