LXL04_013505 | RubberDandelionOmics

Gene overview

LXL04_013505

Reference: OH-1004 Chr: Chr03 Coordinates: 30589147-30592910 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

948 bp · LXL04_013505|LXL04_013505|OH1004|cDNA

ATGAGGAATGGAGATAGTGGATCACCTATACAAACTCCTTTGGTTAACGAAAATTTGTTGCTAATGGAGGCACTTATCGGTACGGGCGCTCTAGAGGAAGCTAGGCACCTGAAACCCAAAAGGAAGAACAAGTGTGTGATCCAAAGAGGTTTCGATCGAACTAAAAACGATAGAGTTGTGAAAGTATCCTGCAAGTTCCTCCGTCGTAAATGCACACAAGAATGCGTTTTCGCACCCTACTTTCCACCAGACCAGCCTCA...

CDS

Download CDS FASTA

948 bp · LXL04_013505|LXL04_013505|OH1004|CDS

ATGAGGAATGGAGATAGTGGATCACCTATACAAACTCCTTTGGTTAACGAAAATTTGTTGCTAATGGAGGCACTTATCGGTACGGGCGCTCTAGAGGAAGCTAGGCACCTGAAACCCAAAAGGAAGAACAAGTGTGTGATCCAAAGAGGTTTCGATCGAACTAAAAACGATAGAGTTGTGAAAGTATCCTGCAAGTTCCTCCGTCGTAAATGCACACAAGAATGCGTTTTCGCACCCTACTTTCCACCAGACCAGCCTCA...

Protein

Download Protein FASTA

315 aa · LXL04_013505|LXL04_013505|OH1004|PROTEIN

MRNGDSGSPIQTPLVNENLLLMEALIGTGALEEARHLKPKRKNKCVIQRGFDRTKNDRVVKVSCKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNELNATQREDAVNSLAYEADARLRDPVYGCVGLISILQHRLRQVQVDLENAKRELANYIGPSAMLPILNQGFIQHSALTYNNNMQPEPVLGLTGPRNFREQNVQNQQMIIGGNGENERPEVIRNYDQQRSSGDHLGFNGGFDAVSASGQVSGGEF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013505`
TK1151 ID	TkA02G492990
OH-1004 ID	LXL04_013505
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 93.358 / OH-1004 80.317 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013505

Location Chr03:30589147-30592910 (-)

Description Similar to LBD36: LOB domain-containing protein 36

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g66870`	Controls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves.	Activation tagging, a novel tool to dissect the functions of a gene family.2003 · DOI: 10.1046/j.1365-313x.2003.01758.x ASYMMETRIC LEAVES2-LIKE1 gene, a member of the AS2/LOB family, controls proximal-distal patterning in Arabidopsis petals.2005 · DOI: 10.1007/s11103-005-0698-4
`At2g23660`	LOB domain-containing protein 10.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0889400`	Negative regulator of cell proliferation in the adaxial side of leaves.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013505 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009954 proximal/distal pattern formation Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0048441 petal development Biological Process

GO:0005634 nucleus Cellular Component

GO:0001216 DNA-binding transcription activator activity Molecular Function

KEGG gene cross-reference

ath:AT2G23660

ath:AT5G66870

dosa:Os01g0889400

zma:100037816

zma:732739

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.972

Rank 1 · LXL04_013505 · OH-1004

Cytoplasm0.085

Rank 2 · LXL04_013505 · OH-1004

Cell membrane0.024

Rank 3 · LXL04_013505 · OH-1004

Endoplasmic reticulum0.016

Rank 4 · LXL04_013505 · OH-1004

Plastid0.011

Rank 5 · LXL04_013505 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03195.20LOB63-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013505	`PF03195.20`	LOB	63	157	1.8e-39	135.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKZ3`	Arabidopsis thaliana	LOB domain-containing protein 36	52.282%	Swiss-Prot	moderate database homology
`O64836`	Arabidopsis thaliana	LOB domain-containing protein 10	42.529%	Swiss-Prot	moderate database homology
`Q8LQH4`	Oryza sativa subsp. japonica	LOB domain-containing protein 6	75.490%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card