Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1337 bp · LXL04_013449|LXL04_013449|OH1004|cDNA
TCTTTAAACCCTAGTCGACTTCCCTTCAAGCCATGGATATCGATGAAAATGTTGAAGATGGTTCAAGAAGAGTACAGGTGCGGTTCATTACGAAGCTTAAACCGCCTTTCAAAGCTCCGGCGACCTCCATTGCTCTCCCTTCTAATCTTACAAGGATGGGCCTTTCAGCCGTCGTTAATAACATGCTTCAATCAGGTAATGATGATTGGAAACCTGAACCATTCGATTTTCTTATCGATGGTGAGTTGGTGAGAATGTCA...
1305 bp · LXL04_013449|LXL04_013449|OH1004|CDS
ATGGATATCGATGAAAATGTTGAAGATGGTTCAAGAAGAGTACAGGTGCGGTTCATTACGAAGCTTAAACCGCCTTTCAAAGCTCCGGCGACCTCCATTGCTCTCCCTTCTAATCTTACAAGGATGGGCCTTTCAGCCGTCGTTAATAACATGCTTCAATCAGGTAATGATGATTGGAAACCTGAACCATTCGATTTTCTTATCGATGGTGAGTTGGTGAGAATGTCACTTGAAGACTTTCTTCTTGCAAAGGGAATTTC...
Protein
Download Protein FASTA434 aa · LXL04_013449|LXL04_013449|OH1004|PROTEIN
MDIDENVEDGSRRVQVRFITKLKPPFKAPATSIALPSNLTRMGLSAVVNNMLQSGNDDWKPEPFDFLIDGELVRMSLEDFLLAKGISAEKTVEIEYIKAVAPRKEEDPSLHDDWVSAVDGSNQFILTGCYDGLGRIWKGAGVCTHVLEGHNGAITSVRVVKPKDNEDTTNTIVATGSKDRTVKLWKIDTESSSDNLKINSFRTLRGHTSSVQSLASQPSGNMICSGSWDCRINLWETECNEGDFVSIKKRKKGSKEEESQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_013449 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_013449 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:29841310-29844892 (-) | ||||||||||||
| Description | Similar to WDR12: Ribosome biogenesis protein WDR12 homolog | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0007219 Notch signaling pathway Biological Process GO:0051726 regulation of cell cycle Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0009506 plasmodesma Cellular Component GO:0030687 preribosome, large subunit precursor Cellular Component GO:0070545 PeBoW complex Cellular Component GO:0080008 Cul4-RING E3 ubiquitin ligase complex Cellular Component GO:0043021 ribonucleoprotein complex binding Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT5G15550 dosa:Os07g0600400 osa:4343819 rno:363237 sasa:106575042 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08154.19NLE14-81 aaPF25047.1Beta-prop_TEP1_2nd111-186 aaPF24807.2WD40_CDC20-Fz113-241 aaPF25173.2Beta-prop_WDR3_1st114-194 aaPF25175.2Beta-prop_WDR5117-238 aaPF24814.2WD40_Prp19120-249 aaPF25391.2WD40_Gbeta121-237 aaPF25174.2Beta-prop_THOC3122-197 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_013449 | PF08154.19 | NLE | 14 | 81 | 4.9e-20 | 72.4 |
| LXL04_013449 | PF25047.1 | Beta-prop_TEP1_2nd | 111 | 186 | 1.4e-20 | 74.2 |
| LXL04_013449 | PF24807.2 | WD40_CDC20-Fz | 113 | 241 | 1.3e-20 | 74.6 |
| LXL04_013449 | PF25173.2 | Beta-prop_WDR3_1st | 114 | 194 | 1.7e-32 | 113.4 |
| LXL04_013449 | PF25175.2 | Beta-prop_WDR5 | 117 | 238 | 8.7e-36 | 124.4 |
| LXL04_013449 | PF24814.2 | WD40_Prp19 | 120 | 249 | 4.9e-28 | 98.7 |
| LXL04_013449 | PF25391.2 | WD40_Gbeta | 121 | 237 | 6.6e-13 | 49.1 |
| LXL04_013449 | PF25174.2 | Beta-prop_THOC3 | 122 | 197 | 1.4e-34 | 120.1 |
| LXL04_013449 | PF23381.2 | Beta-prop_IFT122_1st | 122 | 240 | 3e-27 | 96.4 |
| LXL04_013449 | PF25172.2 | Beta-prop_WDR3_2nd | 122 | 237 | 1.9e-17 | 64.1 |
| LXL04_013449 | PF23414.2 | Beta-prop_EML_2 | 122 | 238 | 3.7e-14 | 53.5 |
| LXL04_013449 | PF25178.1 | Beta-prop_WDR41 | 131 | 238 | 1.3e-08 | 34.7 |
| LXL04_013449 | PF00400.39 | WD40 | 141 | 185 | 1.2e-38 | 130.6 |
| LXL04_013449 | PF24782.3 | WD40_MABP1-WDR62_2nd | 147 | 389 | 5.3e-08 | 32.9 |
| LXL04_013449 | PF24105.2 | Beta-prop_CAF1B_HIR1 | 153 | 342 | 2.1e-15 | 57.3 |
| LXL04_013449 | PF25047.1 | Beta-prop_TEP1_2nd | 169 | 239 | 1.4e-20 | 74.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.