LXL04_013368 | RubberDandelionOmics

Gene overview

LXL04_013368

Reference: OH-1004 Chr: Chr03 Coordinates: 28648575-28651485 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2211 bp · LXL04_013368|LXL04_013368|OH1004|cDNA

ATGGCAACTATGAGTTCTTTGGCATTTGTGACCGATCACACTGCGACTGTTGGCATTGCTCTTATAAACAATCGTCGTCGACCCCAGATCCCTTTGTTCGCATATTATCGACCAAGGAAATCACTTCTTGACATGGCATTTATACGTAATAATACTCCTATCGCTGGTGGTCGCAGAGTTCGGAGTATCAAAGCAACTGGAGAAAAGGGTTACGGTGGAGATGCAAGCGGTGATACAGACGAGGCGCTTCAAGTTGTAAT...

CDS

Download CDS FASTA

2211 bp · LXL04_013368|LXL04_013368|OH1004|CDS

ATGGCAACTATGAGTTCTTTGGCATTTGTGACCGATCACACTGCGACTGTTGGCATTGCTCTTATAAACAATCGTCGTCGACCCCAGATCCCTTTGTTCGCATATTATCGACCAAGGAAATCACTTCTTGACATGGCATTTATACGTAATAATACTCCTATCGCTGGTGGTCGCAGAGTTCGGAGTATCAAAGCAACTGGAGAAAAGGGTTACGGTGGAGATGCAAGCGGTGATACAGACGAGGCGCTTCAAGTTGTAAT...

Protein

Download Protein FASTA

736 aa · LXL04_013368|LXL04_013368|OH1004|PROTEIN

MATMSSLAFVTDHTATVGIALINNRRRPQIPLFAYYRPRKSLLDMAFIRNNTPIAGGRRVRSIKATGEKGYGGDASGDTDEALQVVIEKSKKLLAKQRELLQQIAERREIIASINNTKIKSEKEDILSEDEEESFLELDSNLPDDIFTLQNPSTIKSNEIDDTSKSEIKLPPKTYLRENFKNNHQSTNSQKATTSELPPFVSDISPTYNKIENTNESTTHHIKDVTDAPIGDESQSPPLAGPNVMNIILVAAECAPWSKT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013368`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013368

Location Chr03:28648575-28651485 (+)

Description Similar to Granule-bound starch synthase 2, chloroplastic/amyloplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01180`	Involved in the synthesis of glycan chains within amylopectin in leaves.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0437600`	May be involved in starch synthesis in endosperm amyloplasts and contribute to the deposition of transient starch in chloroplasts of leaves.	Molecular cloning and expression analysis of three genes encoding starch synthase II in rice.2004 · DOI: 10.1007/s00425-003-1189-y
`Os02g0744700`	May contribute to the deposition of transient starch in chloroplasts of leaves.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013368 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010021 amylopectin biosynthetic process Biological Process

GO:0019252 starch biosynthetic process Biological Process

GO:0009501 amyloplast Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004373 alpha-1,4-glucan glucosyltransferase (UDP-glucose donor) activity Molecular Function

GO:0009011 alpha-1,4-glucan glucosyltransferase (ADP-glucose donor) activity Molecular Function

KEGG gene cross-reference

ath:AT3G01180

dosa:Os10g0437600

sot:102583115

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.881

Rank 1 · LXL04_013368 · OH-1004

Golgi apparatus0.064

Rank 2 · LXL04_013368 · OH-1004

Cytoplasm0.043

Rank 3 · LXL04_013368 · OH-1004

Cell membrane0.042

Rank 4 · LXL04_013368 · OH-1004

Endoplasmic reticulum0.035

Rank 5 · LXL04_013368 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08323.18Glyco_transf_5246-488 aa

PF00534.27Glycos_transf_1548-679 aa

PF13692.13Glyco_trans_1_4551-689 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013368	`PF08323.18`	Glyco_transf_5	246	488	8.6e-60	203.1
LXL04_013368	`PF00534.27`	Glycos_transf_1	548	679	5.2e-13	49.6
LXL04_013368	`PF13692.13`	Glyco_trans_1_4	551	689	4.5e-15	56.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MAC8`	Arabidopsis thaliana	Starch synthase 2, chloroplastic/amyloplastic	59.195%	Swiss-Prot	strong database homology
`Q7XE48`	Oryza sativa subsp. japonica	Soluble starch synthase 2-1, chloroplastic/amyloplastic	58.017%	Swiss-Prot	strong database homology
`Q6Z2T8`	Oryza sativa subsp. japonica	Soluble starch synthase 2-2, chloroplastic/amyloplastic	63.435%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card