LXL04_013363 | RubberDandelionOmics

Gene overview

LXL04_013363

Reference: OH-1004 Chr: Chr03 Coordinates: 28580224-28590017 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1305 bp · LXL04_013363|LXL04_013363|OH1004|cDNA

ATGGTAAGGGTGAAAGTTGTGTCGGAAAGTGAAGAATCAGCATTGAATTCGACTAACTCTGTTCCATTGAGCAACTTTAGGGTGGTCGTCAGGTATGTGGAGTGTCATCGGAACTACGCCTGCCGTGAAGGTGGACACCGTGTTGATGGTTGTCAGGAGTATATCCCCAACCAGGAGGACGTGGCAGACCCCCCAGAGCTGCTATGTGCCAATTGCGGCTGTCACCGCAACTTCCATAGGAGGGTGGTGGTGACGGAAGT...

CDS

Download CDS FASTA

1305 bp · LXL04_013363|LXL04_013363|OH1004|CDS

ATGGTAAGGGTGAAAGTTGTGTCGGAAAGTGAAGAATCAGCATTGAATTCGACTAACTCTGTTCCATTGAGCAACTTTAGGGTGGTCGTCAGGTATGTGGAGTGTCATCGGAACTACGCCTGCCGTGAAGGTGGACACCGTGTTGATGGTTGTCAGGAGTATATCCCCAACCAGGAGGACGTGGCAGACCCCCCAGAGCTGCTATGTGCCAATTGCGGCTGTCACCGCAACTTCCATAGGAGGGTGGTGGTGACGGAAGT...

Protein

Download Protein FASTA

434 aa · LXL04_013363|LXL04_013363|OH1004|PROTEIN

MVRVKVVSESEESALNSTNSVPLSNFRVVVRYVECHRNYACREGGHRVDGCQEYIPNQEDVADPPELLCANCGCHRNFHRRVVVTEVIGNGIWKDVIKAIYGEDGGFDRQLNSGMRGTVWGNIIRIKDNLQEVGINLDNILYEADTGANTTGAGWQWGLNGQLDFTTSSLRKLVDGKTLVDFRLPRWWTSTVPCKINVFIWRACLGRLPTRYNLVKRGISIPALTCPWCNRCDETEQHLFFECSTSKDLQAHLFSWWAPA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013363`
TK1151 ID	TkA04G356290
OH-1004 ID	LXL04_013363
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	36.300
Protein coverage (%)	TK1151 66.509 / OH-1004 38.710 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013363

Location Chr03:28580224-28590017 (+)

Description Similar to MIF3: Mini zinc finger protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g18835`	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties.	Ectopic expression of the Arabidopsis MINI ZINC FINGER1 and MIF3 genes induces shoot meristems on leaf margins.2011 · DOI: 10.1007/s11103-011-9768-y
`At3g28917`	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties.	No verified direct reference in this release
`At1g74660`	Inhibits zinc finger homeodomain (ZHD) transcription factors, such as ZHD5, by interacting with them to prevent both their nuclear localization and their DNA-binding properties.	Characterization of a novel putative zinc finger gene MIF1: involvement in multiple hormonal regulation of Arabidopsis development.2006 · DOI: 10.1111/j.1365-313x.2005.02626.x Nuclear import and DNA binding of the ZHD5 transcription factor is modulated by a competitive peptide inhibitor in Arabidopsis.2011 · DOI: 10.1074/jbc.m110.167692 Ectopic expression of the Arabidopsis MINI ZINC FINGER1 and MIF3 genes induces shoot meristems on leaf margins.2011 · DOI: 10.1007/s11103-011-9768-y
`At5g60480`	Putative transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0438100`	Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013363 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009733 response to auxin Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0010582 floral meristem determinacy Biological Process

GO:0035670 plant-type ovary development Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048509 regulation of meristem development Biological Process

KEGG gene cross-reference

ath:AT1G18835

ath:AT1G74660

ath:AT3G28917

ath:AT5G60480

dosa:Os08g0438100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.528

Rank 1 · LXL04_013363 · OH-1004

Nucleus0.306

Rank 2 · LXL04_013363 · OH-1004

Cell membrane0.192

Rank 3 · LXL04_013363 · OH-1004

Mitochondrion0.064

Rank 4 · LXL04_013363 · OH-1004

Golgi apparatus0.063

Rank 5 · LXL04_013363 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04770.18ZF-HD_dimer30-82 aa

PF13966.12zf-RVT170-248 aa

PF13966.12zf-RVT309-348 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013363	`PF04770.18`	ZF-HD_dimer	30	82	1.3e-21	77.4
LXL04_013363	`PF13966.12`	zf-RVT	170	248	1.2e-23	84.2
LXL04_013363	`PF13966.12`	zf-RVT	309	348	1.2e-23	84.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q2Q493`	Arabidopsis thaliana	Mini zinc finger protein 3	57.627%	Swiss-Prot	weak database homology
`Q9LJW5`	Arabidopsis thaliana	Mini zinc finger protein 2	49.153%	Swiss-Prot	weak database homology
`Q9CA51`	Arabidopsis thaliana	Mini zinc finger protein 1	55.000%	Swiss-Prot	weak database homology
`Q9FKJ9`	Arabidopsis thaliana	Zinc-finger homeodomain protein 12	54.545%	Swiss-Prot	weak database homology
`Q0J5F8`	Oryza sativa subsp. japonica	Mini zinc finger protein 4	57.895%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card