LXL04_013272 | RubberDandelionOmics

Gene overview

LXL04_013272

Reference: OH-1004 Chr: Chr03 Coordinates: 26902923-26904710 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

618 bp · LXL04_013272|LXL04_013272|OH1004|cDNA

ATGTCGTCGCATCCGGCCACCGCTAGTCTGTATCTCCTCGGTCAACTACTGATTTCGATTTCTGATAATTGGATTCCGAATTCTAATAGGGATAAGATCCGGTGCTTGACAATGGCATCTCATATTGTCGGTTATCCACGTATGGGACCAAAACGAGAACTGAAATTTGCGCTTGAATCGTTTTGGGATGGTAGGAGCAGTGCCGACGACTTGCAGAAAGTTGCTTCTGACTTTCGATCAAGCATCTGGAAACAGATGAT...

CDS

Download CDS FASTA

618 bp · LXL04_013272|LXL04_013272|OH1004|CDS

ATGTCGTCGCATCCGGCCACCGCTAGTCTGTATCTCCTCGGTCAACTACTGATTTCGATTTCTGATAATTGGATTCCGAATTCTAATAGGGATAAGATCCGGTGCTTGACAATGGCATCTCATATTGTCGGTTATCCACGTATGGGACCAAAACGAGAACTGAAATTTGCGCTTGAATCGTTTTGGGATGGTAGGAGCAGTGCCGACGACTTGCAGAAAGTTGCTTCTGACTTTCGATCAAGCATCTGGAAACAGATGAT...

Protein

Download Protein FASTA

205 aa · LXL04_013272|LXL04_013272|OH1004|PROTEIN

MSSHPATASLYLLGQLLISISDNWIPNSNRDKIRCLTMASHIVGYPRMGPKRELKFALESFWDGRSSADDLQKVASDFRSSIWKQMIKDAGIKYIPSNTFSFYDQVHDTTCHGNDQMVRHKLLGVDTVPVLVGPVSYLLLSKPAKGVDKTFNLLSLLDKILPVYKVLLECIKVQVSSTLMLQRLKKDVLTELLSNEGNRCKRFRF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013272`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013272

Location Chr03:26902923-26904710 (+)

Description Similar to METE: 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0624000`	Catalyzes the transfer of a methyl group from 5-methyltetrahydrofolate to homocysteine resulting in methionine formation.	No verified direct reference in this release
`Os12g0623900`	Catalyzes the transfer of a methyl group from 5-methyltetrahydrofolate to homocysteine resulting in methionine formation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013272 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009086 methionine biosynthetic process Biological Process

GO:0032259 methylation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003871 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0008705 methionine synthase activity Molecular Function

KEGG gene cross-reference

ag:CAA58474

dosa:Os12g0624000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.292

Rank 1 · LXL04_013272 · OH-1004

Plastid0.254

Rank 2 · LXL04_013272 · OH-1004

Mitochondrion0.225

Rank 3 · LXL04_013272 · OH-1004

Nucleus0.139

Rank 4 · LXL04_013272 · OH-1004

Peroxisome0.121

Rank 5 · LXL04_013272 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08267.19Meth_synt_140-112 aa

PF08267.19Meth_synt_1116-174 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013272	`PF08267.19`	Meth_synt_1	40	112	3.3e-34	119.5
LXL04_013272	`PF08267.19`	Meth_synt_1	116	174	3.3e-34	119.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q2QLY4`	Oryza sativa subsp. japonica	5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 2	85.135%	Swiss-Prot	weak database homology
`Q2QLY5`	Oryza sativa subsp. japonica	5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 1	83.784%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card