LXL04_011552 | RubberDandelionOmics

Gene overview

LXL04_011552

Reference: OH-1004 Chr: Chr02 Coordinates: 167147244-167149164 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1155 bp · LXL04_011552|LXL04_011552|OH1004|cDNA

ATGGACCATCATTCATATCACAACCCCCACGAACGGCGGACCTTCATCAAGTCTAAAACTCCTTCTGTTAAATGGTTCAAAGAATGGGTACCACAAGAGGTTGTGTCAACAGGTGGCAAATGCTTCGTTATGAAATGGGTCACAGAGGCTCAATTAAACGCCATGAAAGAAGAAAAGTCAAAAGAGATGGAATCTGTAGAACCTGAACCTGAACCAACAACCGAAGTTCTTTTCCTCTGTAGCTATGAAGGCTGTGGAAA...

CDS

Download CDS FASTA

1155 bp · LXL04_011552|LXL04_011552|OH1004|CDS

ATGGACCATCATTCATATCACAACCCCCACGAACGGCGGACCTTCATCAAGTCTAAAACTCCTTCTGTTAAATGGTTCAAAGAATGGGTACCACAAGAGGTTGTGTCAACAGGTGGCAAATGCTTCGTTATGAAATGGGTCACAGAGGCTCAATTAAACGCCATGAAAGAAGAAAAGTCAAAAGAGATGGAATCTGTAGAACCTGAACCTGAACCAACAACCGAAGTTCTTTTCCTCTGTAGCTATGAAGGCTGTGGAAA...

Protein

Download Protein FASTA

384 aa · LXL04_011552|LXL04_011552|OH1004|PROTEIN

MDHHSYHNPHERRTFIKSKTPSVKWFKEWVPQEVVSTGGKCFVMKWVTEAQLNAMKEEKSKEMESVEPEPEPTTEVLFLCSYEGCGKTFIDAGALRKHSHIHGERQYACHFENCGKKFLDSSKLKRHFLIHTGERDFVCPHEGCGKAFSLDFNLRSHMKTHSQENYHLCPYPECGKRYAHEYKLKNHIMSHHEKFQQNNNHMMVEAPLKYVHVQPVENPKPPPKPTKSTTTAYASASSDRPYACPYEGCEKAYIHEYKLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011552`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011552

Location Chr02:167147244-167149164 (+)

Description Similar to YY1: Zinc finger transcription factor YY1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g06634`	Dual-function transcription factor with both repression and activation activities.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011552 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006952 defense response Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT4G06634

hsa:404281

rno:103690827

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.960

Rank 1 · LXL04_011552 · OH-1004

Cytoplasm0.135

Rank 2 · LXL04_011552 · OH-1004

Cell membrane0.019

Rank 3 · LXL04_011552 · OH-1004

Mitochondrion0.016

Rank 4 · LXL04_011552 · OH-1004

Endoplasmic reticulum0.010

Rank 5 · LXL04_011552 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30018.1zf-C2H2_ATbp_2nd104-131 aa

PF13465.13zf-H2C2_2124-149 aa

PF00096.33zf-C2H2137-161 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011552	`PF30018.1`	zf-C2H2_ATbp_2nd	104	131	7.6e-06	26.3
LXL04_011552	`PF13465.13`	zf-H2C2_2	124	149	1.4e-07	32.2
LXL04_011552	`PF00096.33`	zf-C2H2	137	161	9.6e-18	64.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q2V3L3`	Arabidopsis thaliana	Zinc finger transcription factor YY1	58.380%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card