Gene Card
Gene overview
cDNA / CDS / Protein Sequences
843 bp · LXL04_011191|LXL04_011191|OH1004|cDNA
ATGCACCAGAGATACAAAATGGCCGCGGTTGTCCCTCAAAGATTAGTCCAATCATACATTGGACGTAACCTATCGGGACGTCTTATAACTATATCACATTTCCAAATTGATGCGTTATTGGATGACTATCCAAGATATCATGGTTACAGTTTTATACGTGATCAAGCAGTTATCGATATCACGATGGTACCTACACGTCCAACGTTGTTTACAAAGAAGTCTTATGTGATTAATAAGGCTACGTCGGTCGTTGCTGCTTC...
843 bp · LXL04_011191|LXL04_011191|OH1004|CDS
ATGCACCAGAGATACAAAATGGCCGCGGTTGTCCCTCAAAGATTAGTCCAATCATACATTGGACGTAACCTATCGGGACGTCTTATAACTATATCACATTTCCAAATTGATGCGTTATTGGATGACTATCCAAGATATCATGGTTACAGTTTTATACGTGATCAAGCAGTTATCGATATCACGATGGTACCTACACGTCCAACGTTGTTTACAAAGAAGTCTTATGTGATTAATAAGGCTACGTCGGTCGTTGCTGCTTC...
Protein
Download Protein FASTA280 aa · LXL04_011191|LXL04_011191|OH1004|PROTEIN
MHQRYKMAAVVPQRLVQSYIGRNLSGRLITISHFQIDALLDDYPRYHGYSFIRDQAVIDITMVPTRPTLFTKKSYVINKATSVVAASGIKFHHVLFDILRSSQFPGEPLYTDDPTTPPDSSETTALTVSSSHHILKLTSPTSIRVRIKSTSLNYANYLQVLGKYQEKLVLSFVPGSDYSGVVDFVGPKVTKFKVGDPVCSFAGVSSFAQFVVAEEKDLFGVPDGCDLVAAGALPVAYGTSHMALVHTAKLKAGQQKTSYL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_011191 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_011191 |
|---|---|
| Location | Chr02:159731357-159735160 (-) |
| Description | Similar to Quinone oxidoreductase-like protein 2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006633 fatty acid biosynthetic process Biological Process GO:0033068 macrolide biosynthetic process Biological Process GO:0005739 mitochondrion Cellular Component GO:0004312 fatty acid synthase activity Molecular Function GO:0004315 3-oxoacyl-[acyl-carrier-protein] synthase activity Molecular Function GO:0016491 oxidoreductase activity Molecular Function GO:0031177 phosphopantetheine binding Molecular Function GO:0047879 erythronolide synthase activity Molecular Function |
| KEGG gene cross-reference | mmu:226527 nve:5520320 rno:289138 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08240.18ADH_N140-223 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_011191 | PF08240.18 | ADH_N | 140 | 223 | 7e-11 | 43.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.