LXL04_011033 | RubberDandelionOmics

Gene overview

LXL04_011033

Reference: OH-1004 Chr: Chr02 Coordinates: 156748131-156753985 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1581 bp · LXL04_011033|LXL04_011033|OH1004|cDNA

ATGGATTCCGCCGCCATGACATTTTGCAGTAAACCAATCACCTCTCCTCCGGGTTTATTCATCGGGAGGTCTGGCGGACTCAAGAGCTCCCAATGTAGCTTCTTGGTGGGAAACAAGGTGAGCTTTCCAAGACAAAGAGTTCAAGCTTCCCAAAAAGCTCGCAAATCAGCAAAACACGAAGGAGCTCTCGGTGCCACCTGTCGTGCTGAAAAGATCCTGATAGCAAACAGAGGTGAAATTGCAGTACGTGTAATTCGAAC...

CDS

Download CDS FASTA

1581 bp · LXL04_011033|LXL04_011033|OH1004|CDS

ATGGATTCCGCCGCCATGACATTTTGCAGTAAACCAATCACCTCTCCTCCGGGTTTATTCATCGGGAGGTCTGGCGGACTCAAGAGCTCCCAATGTAGCTTCTTGGTGGGAAACAAGGTGAGCTTTCCAAGACAAAGAGTTCAAGCTTCCCAAAAAGCTCGCAAATCAGCAAAACACGAAGGAGCTCTCGGTGCCACCTGTCGTGCTGAAAAGATCCTGATAGCAAACAGAGGTGAAATTGCAGTACGTGTAATTCGAAC...

Protein

Download Protein FASTA

526 aa · LXL04_011033|LXL04_011033|OH1004|PROTEIN

MDSAAMTFCSKPITSPPGLFIGRSGGLKSSQCSFLVGNKVSFPRQRVQASQKARKSAKHEGALGATCRAEKILIANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSNQSYLLIPNVLSAAISHGCTMLHPGYGFLAENAVFVEMCRGHGINFIGPNPDSIRVMGDKATARDTMKNAGVPCVPGGEGLLQSTEEGIKLADEIGYPVMIKATAGGGGRGMRLAKERGEFVKLLQQAQSEAAAAFG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011033`
TK1151 ID	TkA03G561380
OH-1004 ID	LXL04_011033
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011033

Location Chr02:156748131-156753985 (-)

Description Similar to POPTRDRAFT_831870: Biotin carboxylase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g35360`	This protein is a component of the acetyl coenzyme A carboxylase complex.	Biochemical and molecular biological characterization of CAC2, the Arabidopsis thaliana gene coding for the biotin carboxylase subunit of the plastidic acetyl-coenzyme A carboxylase.1997 · DOI: 10.1104/pp.115.4.1371

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011033 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006094 gluconeogenesis Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:2001295 malonyl-CoA biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0003989 acetyl-CoA carboxylase activity Molecular Function

GO:0004075 biotin carboxylase activity Molecular Function

GO:0004736 pyruvate carboxylase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ana:alr0939

ath:AT5G35360

mth:MTH_1917

pop:18107844

pop:7485516

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.932

Rank 1 · LXL04_011033 · OH-1004

Mitochondrion0.116

Rank 2 · LXL04_011033 · OH-1004

Cytoplasm0.038

Rank 3 · LXL04_011033 · OH-1004

Nucleus0.021

Rank 4 · LXL04_011033 · OH-1004

Peroxisome0.018

Rank 5 · LXL04_011033 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00289.29Biotin_carb_N70-177 aa

PF02786.23CPSase_L_D2182-389 aa

PF02222.28ATP-grasp205-359 aa

PF07478.19Dala_Dala_lig_C212-358 aa

PF02785.26Biotin_carb_C403-509 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011033	`PF00289.29`	Biotin_carb_N	70	177	2.1e-40	138.3
LXL04_011033	`PF02786.23`	CPSase_L_D2	182	389	3.2e-81	272.6
LXL04_011033	`PF02222.28`	ATP-grasp	205	359	4.6e-11	43.4
LXL04_011033	`PF07478.19`	Dala_Dala_lig_C	212	358	2.6e-07	31.1
LXL04_011033	`PF02785.26`	Biotin_carb_C	403	509	3.7e-39	133.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04983`	Arabidopsis thaliana	Biotin carboxylase, chloroplastic	85.086%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card