LXL04_010997 | RubberDandelionOmics

Gene overview

LXL04_010997

Reference: OH-1004 Chr: Chr02 Coordinates: 156219395-156220632 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1038 bp · LXL04_010997|LXL04_010997|OH1004|cDNA

ATGGCAAAAAAACCTTGGTTTACACTTGTGTTCCCATACATACTATACTTCATACTCCAACAAGCCAAGTCTCACAAACCCGACACCACAAACTACACATTGCAAAAGTACGAAAAATGGCTACAAAAATACGAGAGAGTATACCAAAGCCAAAATGAGCAACAACTTAGATTTGGTATTTACAAATCTAATCTCGAATATATCAACTATATCAATTCACAAAATGTTTCCTACAAGCTCACCGACAACAAGTACGCAGA...

CDS

Download CDS FASTA

1038 bp · LXL04_010997|LXL04_010997|OH1004|CDS

ATGGCAAAAAAACCTTGGTTTACACTTGTGTTCCCATACATACTATACTTCATACTCCAACAAGCCAAGTCTCACAAACCCGACACCACAAACTACACATTGCAAAAGTACGAAAAATGGCTACAAAAATACGAGAGAGTATACCAAAGCCAAAATGAGCAACAACTTAGATTTGGTATTTACAAATCTAATCTCGAATATATCAACTATATCAATTCACAAAATGTTTCCTACAAGCTCACCGACAACAAGTACGCAGA...

Protein

Download Protein FASTA

345 aa · LXL04_010997|LXL04_010997|OH1004|PROTEIN

MAKKPWFTLVFPYILYFILQQAKSHKPDTTNYTLQKYEKWLQKYERVYQSQNEQQLRFGIYKSNLEYINYINSQNVSYKLTDNKYADMTHEEFSTFHFGYNGQEHSDSGELNNSHSKSNTTEDLPEDVDWRKRGAVTHVRDQDHCGACWAFSAVAAIEGINKIKGGNLTILSEQMLVDCDVNNGDKGCRGGIMEKAYQFVKKNGGITTEQVYPYVGIDEGCNKSKAKDTVVRLRGYESIKSKDEKSLQSAVAKQPVSVPI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010997`
TK1151 ID	TkA03G559910
OH-1004 ID	LXL04_010997
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	88.600
Protein coverage (%)	TK1151 100.000 / OH-1004 97.681 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010997

Location Chr02:156219395-156220632 (+)

Description Similar to CEP2: KDEL-tailed cysteine endopeptidase CEP2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48340`	Involved in the final stage of developmental programmed cell death and in intercalation of new cells.	KDEL-tailed cysteine endopeptidases involved in programmed cell death, intercalation of new cells, and dismantling of extensin scaffolds.2008 · DOI: 10.3732/ajb.2007404
`At5g45890`	Cysteine protease that may have a developmental senescence specific cell death function during apoptosis, heavy metal detoxification, and hypersensitive response.	Identification of a promoter region responsible for the senescence-specific expression of SAG12.1999 · DOI: 10.1023/a:1006342412688 HDA6 is required for jasmonate response, senescence and flowering in Arabidopsis.2008 · DOI: 10.1093/jxb/erm300 Natural developmental variations in leaf and plant senescence in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1438-8677.2008.00108.x Epigenetic programming via histone methylation at WRKY53 controls leaf senescence in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1365-313x.2008.03782.x Nitric oxide is involved in cadmium-induced programmed cell death in Arabidopsis suspension cultures.2009 · DOI: 10.1104/pp.108.133397
`At5g50260`	Possesses protease activity in vitro.	KDEL-tailed cysteine endopeptidases involved in programmed cell death, intercalation of new cells, and dismantling of extensin scaffolds.2008 · DOI: 10.3732/ajb.2007404 Endoplasmic reticulum KDEL-tailed cysteine endopeptidase 1 of Arabidopsis (AtCEP1) is involved in pathogen defense.2014 · DOI: 10.3389/fpls.2014.00058 The cysteine protease CEP1, a key executor involved in tapetal programmed cell death, regulates pollen development in Arabidopsis.2014 · DOI: 10.1105/tpc.114.127282

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0206300`	Cysteine protease that may have a developmental senescence specific cell death function during apoptosis, heavy metal detoxification, and hypersensitive response.	No verified direct reference in this release
`UniProt: A2XQE8`	Cysteine protease that may have a developmental senescence specific cell death function during apoptosis, heavy metal detoxification, and hypersensitive response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010997 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009555 pollen development Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009733 response to auxin Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009749 response to glucose Biological Process

GO:0009750 response to fructose Biological Process

GO:0010150 leaf senescence Biological Process

KEGG gene cross-reference

ath:AT3G48340

ath:AT5G45890

ath:AT5G50260

osa:107276017

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.623

Rank 1 · LXL04_010997 · OH-1004

Cytoplasm0.195

Rank 2 · LXL04_010997 · OH-1004

Extracellular0.175

Rank 3 · LXL04_010997 · OH-1004

Endoplasmic reticulum0.146

Rank 4 · LXL04_010997 · OH-1004

Cell membrane0.111

Rank 5 · LXL04_010997 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08246.18Inhibitor_I2937-93 aa

PF00112.30Peptidase_C1124-342 aa

PF03051.22Peptidase_C1_2280-320 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010997	`PF08246.18`	Inhibitor_I29	37	93	3.3e-17	63.3
LXL04_010997	`PF00112.30`	Peptidase_C1	124	342	4.8e-78	262.9
LXL04_010997	`PF03051.22`	Peptidase_C1_2	280	320	9.5e-07	28.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STL4`	Arabidopsis thaliana	KDEL-tailed cysteine endopeptidase CEP2	45.115%	Swiss-Prot	moderate database homology
`Q9FJ47`	Arabidopsis thaliana	Senescence-specific cysteine protease SAG12	43.020%	Swiss-Prot	moderate database homology
`Q9FGR9`	Arabidopsis thaliana	KDEL-tailed cysteine endopeptidase CEP1	45.190%	Swiss-Prot	moderate database homology
`Q7XWK5`	Oryza sativa subsp. japonica	Senescence-specific cysteine protease SAG39	41.570%	Swiss-Prot	moderate database homology
`A2XQE8`	Oryza sativa subsp. indica	Senescence-specific cysteine protease SAG39	41.399%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card