Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3300 bp · LXL04_010886|LXL04_010886|OH1004|cDNA
atggatACATCCGCCTGTATAAAAGAAGTGAATAGATCGGCATCGGTGGCCTTTGCGCCCGAAGCGCCGCTCATTGCCGCAGGCACTATGGCGGGAGCTGTCGATATGTCGTTCAGCTCCTCCGCAAATCTGGAAATCTTTCAACTTGACTTCCAATCCGACGATCGCAAGCTTCCCTTAGTTGGCGCGATACCTATTACCGAACCATTTAATCGCCTATCATGGGGAAAATCCCCGACAGCGGGTTCGGAGGAATTCTC...
3300 bp · LXL04_010886|LXL04_010886|OH1004|CDS
ATGGATACATCCGCCTGTATAAAAGAAGTGAATAGATCGGCATCGGTGGCCTTTGCGCCCGAAGCGCCGCTCATTGCCGCAGGCACTATGGCGGGAGCTGTCGATATGTCGTTCAGCTCCTCCGCAAATCTGGAAATCTTTCAACTTGACTTCCAATCCGACGATCGCAAGCTTCCCTTAGTTGGCGCGATACCTATTACCGAACCATTTAATCGCCTATCATGGGGAAAATCCCCGACAGCGGGTTCGGAGGAATTCTC...
Protein
Download Protein FASTA1099 aa · LXL04_010886|LXL04_010886|OH1004|PROTEIN
MDTSACIKEVNRSASVAFAPEAPLIAAGTMAGAVDMSFSSSANLEIFQLDFQSDDRKLPLVGAIPITEPFNRLSWGKSPTAGSEEFSLGLVAGGLVDGNIGIWNPRILISSEEKEGALVQQLTRHKGPVRGLEFSGLSPNHLASGAEEGEICIWDISKPTEPTHFPPLKGNASAKQGEISYLSWNRKVQPILASTSFNGTTVVWDLRKQKPIISFSDSVRRRCSVLQWHPDFATQLIVASDDDSSPSLRIWDMRNTMSPL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_010886 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_010886 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:154871857-154877793 (-) | |||||||||
| Description | Similar to SEC31B: Protein transport protein SEC31 homolog B | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0007029 endoplasmic reticulum organization Biological Process GO:0015031 protein transport Biological Process GO:0051592 response to calcium ion Biological Process GO:0090110 COPII-coated vesicle cargo loading Biological Process GO:0005737 cytoplasm Cellular Component GO:0005768 endosome Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005829 cytosol Cellular Component GO:0009506 plasmodesma Cellular Component GO:0030120 vesicle coat Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G18830 ath:AT3G63460 gga:422597 mmu:69162 pon:100173999 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF24814.2WD40_Prp1990-159 aaPF25047.1Beta-prop_TEP1_2nd90-226 aaPF24796.2WDR5590-216 aaPF24807.2WD40_CDC20-Fz91-158 aaPF25173.2Beta-prop_WDR3_1st91-158 aaPF24105.2Beta-prop_CAF1B_HIR191-254 aaPF25175.2Beta-prop_WDR597-210 aaPF23381.2Beta-prop_IFT122_1st113-340 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_010886 | PF24814.2 | WD40_Prp19 | 90 | 159 | 1.3e-15 | 57.9 |
| LXL04_010886 | PF25047.1 | Beta-prop_TEP1_2nd | 90 | 226 | 1.7e-15 | 57.6 |
| LXL04_010886 | PF24796.2 | WDR55 | 90 | 216 | 2.7e-09 | 37.2 |
| LXL04_010886 | PF24807.2 | WD40_CDC20-Fz | 91 | 158 | 4.8e-21 | 76.0 |
| LXL04_010886 | PF25173.2 | Beta-prop_WDR3_1st | 91 | 158 | 5.7e-18 | 66.0 |
| LXL04_010886 | PF24105.2 | Beta-prop_CAF1B_HIR1 | 91 | 254 | 2.2e-13 | 50.7 |
| LXL04_010886 | PF25175.2 | Beta-prop_WDR5 | 97 | 210 | 9.9e-22 | 78.3 |
| LXL04_010886 | PF23381.2 | Beta-prop_IFT122_1st | 113 | 340 | 1e-17 | 65.1 |
| LXL04_010886 | PF25174.2 | Beta-prop_THOC3 | 125 | 243 | 2.7e-21 | 76.5 |
| LXL04_010886 | PF23098.2 | Beta-prop_NOL10_N | 130 | 257 | 4.7e-06 | 26.7 |
| LXL04_010886 | PF24807.2 | WD40_CDC20-Fz | 174 | 330 | 4.8e-21 | 76.0 |
| LXL04_010886 | PF25173.2 | Beta-prop_WDR3_1st | 176 | 338 | 5.7e-18 | 66.0 |
| LXL04_010886 | PF24814.2 | WD40_Prp19 | 176 | 273 | 1.3e-15 | 57.9 |
| LXL04_010886 | PF24817.2 | WD40_WDHD1_1st | 177 | 239 | 2e-11 | 44.4 |
| LXL04_010886 | PF23414.2 | Beta-prop_EML_2 | 191 | 308 | 2.4e-11 | 44.2 |
| LXL04_010886 | PF29037.1 | DSE1_N | 220 | 299 | 5.8e-12 | 46.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.