LXL04_010842 | RubberDandelionOmics

Gene overview

LXL04_010842

Reference: OH-1004 Chr: Chr02 Coordinates: 154364701-154366371 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

750 bp · LXL04_010842|LXL04_010842|OH1004|cDNA

ATGGCAATGGCTTCACGAGTCAGATCAACCGTCACCGGTGTAACAAAGGCTCTGATCTCTGATTCCTTCTCATCTCAGAGATCAACCGTCGCACCAGCCTTGATTTGCCCTAATTTTACCAATTCCGAGCAATCGAGAAACTTTGCAGCTCCCGCTACCCCCAAGGAACCAAAGATCAAAGTACCCGTGGCCATGTTTGGCGGCTCAGGAAACTACGCCTCTGCTTTATACATTGCAGCAGCAAAAGCCAAATCATTAGA...

CDS

Download CDS FASTA

750 bp · LXL04_010842|LXL04_010842|OH1004|CDS

ATGGCAATGGCTTCACGAGTCAGATCAACCGTCACCGGTGTAACAAAGGCTCTGATCTCTGATTCCTTCTCATCTCAGAGATCAACCGTCGCACCAGCCTTGATTTGCCCTAATTTTACCAATTCCGAGCAATCGAGAAACTTTGCAGCTCCCGCTACCCCCAAGGAACCAAAGATCAAAGTACCCGTGGCCATGTTTGGCGGCTCAGGAAACTACGCCTCTGCTTTATACATTGCAGCAGCAAAAGCCAAATCATTAGA...

Protein

Download Protein FASTA

249 aa · LXL04_010842|LXL04_010842|OH1004|PROTEIN

MAMASRVRSTVTGVTKALISDSFSSQRSTVAPALICPNFTNSEQSRNFAAPATPKEPKIKVPVAMFGGSGNYASALYIAAAKAKSLDKVESELIDFVNATSKASTFSQFMKDLAVPADTRVKAVTEICTQAKFSDVTKNFLVVLADNGRLRHVDTIAKRFSDLTMAHRGEVKAIVTTVIPLPAEEEKELKETLQHILGKGKKVILEQKIDGSILGGIVVEFGQKVFDMSIKTRAKQMERFLRDPINFDA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010842`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010842

Location Chr02:154364701-154366371 (+)

Description Similar to ATP synthase subunit O, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13450`	Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010842 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0042776 proton motive force-driven mitochondrial ATP synthesis Biological Process

GO:0071320 cellular response to cAMP Biological Process

GO:0071345 cellular response to cytokine stimulus Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009986 cell surface Cellular Component

GO:0045259 proton-transporting ATP synthase complex Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0044877 protein-containing complex binding Molecular Function

KEGG gene cross-reference

ath:AT5G13450

cjc:103789634

pon:100172045

rno:192241

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.872

Rank 1 · LXL04_010842 · OH-1004

Plastid0.095

Rank 2 · LXL04_010842 · OH-1004

Cytoplasm0.040

Rank 3 · LXL04_010842 · OH-1004

Nucleus0.024

Rank 4 · LXL04_010842 · OH-1004

Extracellular0.018

Rank 5 · LXL04_010842 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00213.24OSCP70-239 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010842	`PF00213.24`	OSCP	70	239	6.8e-45	154.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96251`	Arabidopsis thaliana	ATP synthase subunit O, mitochondrial	51.417%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card