LXL04_010765 | RubberDandelionOmics

Gene overview

LXL04_010765

Reference: OH-1004 Chr: Chr02 Coordinates: 152921184-152922976 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1005 bp · LXL04_010765|LXL04_010765|OH1004|cDNA

ATGGGGAACAGTGAAGAAGCAAAGAATTCCAAACCAGAAGTAACATCTTCTTCACCTCCTCCCGAACAACAGCAGACAGGTCATGTCTATCCTGATTGGGCAGCCATGCAGGCATACTATGGCCCAAGAATGGCTGTGCCACAATACTTCAACTCACCTGTTACATCTGGTCATCCACCTCCACCTTACATGTGGGCCCCTCCATTACAGCATATGATGCCACCTTATGCTGCAATGTATCCACATGCAGGTGTCTATGC...

CDS

Download CDS FASTA

1005 bp · LXL04_010765|LXL04_010765|OH1004|CDS

ATGGGGAACAGTGAAGAAGCAAAGAATTCCAAACCAGAAGTAACATCTTCTTCACCTCCTCCCGAACAACAGCAGACAGGTCATGTCTATCCTGATTGGGCAGCCATGCAGGCATACTATGGCCCAAGAATGGCTGTGCCACAATACTTCAACTCACCTGTTACATCTGGTCATCCACCTCCACCTTACATGTGGGCCCCTCCATTACAGCATATGATGCCACCTTATGCTGCAATGTATCCACATGCAGGTGTCTATGC...

Protein

Download Protein FASTA

334 aa · LXL04_010765|LXL04_010765|OH1004|PROTEIN

MGNSEEAKNSKPEVTSSSPPPEQQQTGHVYPDWAAMQAYYGPRMAVPQYFNSPVTSGHPPPPYMWAPPLQHMMPPYAAMYPHAGVYAHPGVTVAASPTPMHVDSPAKSSGGLVKKLKGFDGLAMSIGNENGISHSGETEGSSEGSDGNTKSGQKISRGSSTSSEVGKMDDQLPSTNENESFKKVTNLTVNIMQNERELKRERRKQSNRESARRSRLRKQAEAEGLGSRVETLTTENLTLKSEINRLTVISSNLKLQNAKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010765`
TK1151 ID	TkA03G548110
OH-1004 ID	LXL04_010765
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.500
Protein coverage (%)	TK1151 95.714 / OH-1004 40.120 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010765

Location Chr02:152921184-152922976 (-)

Description Similar to GBF3: G-box-binding factor 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46270`	Binds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter.	No verified direct reference in this release
`At4g01120`	Binds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter.	No verified direct reference in this release
`At4g36730`	Binds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter.	No verified direct reference in this release
`At1g32150`	Transcriptional activator that binds to the G-box motif (5'-CACGTG-3') and other cis-acting elements with 5'-ACGT-3' core, such as Hex, C-box and as-1 motifs.	AtbZIP16 and AtbZIP68, two new members of GBFs, can interact with other G group bZIPs in Arabidopsis thaliana.2008 · DOI: 10.5483/bmbrep.2008.41.2.132 Redox-mediated mechanisms regulate DNA binding activity of the G-group of basic region leucine zipper (bZIP) transcription factors in Arabidopsis.2012 · DOI: 10.1074/jbc.m112.361394

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010765 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009637 response to blue light Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT1G32150

ath:AT2G46270

ath:AT4G01120

ath:AT4G36730

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · LXL04_010765 · OH-1004

Cytoplasm0.086

Rank 2 · LXL04_010765 · OH-1004

Cell membrane0.029

Rank 3 · LXL04_010765 · OH-1004

Endoplasmic reticulum0.014

Rank 4 · LXL04_010765 · OH-1004

Plastid0.008

Rank 5 · LXL04_010765 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07777.17MFMR1-91 aa

PF00170.27bZIP_1195-257 aa

PF07716.21bZIP_2197-246 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010765	`PF07777.17`	MFMR	1	91	3.3e-27	95.6
LXL04_010765	`PF00170.27`	bZIP_1	195	257	6e-20	71.8
LXL04_010765	`PF07716.21`	bZIP_2	197	246	2e-08	34.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P42776`	Arabidopsis thaliana	G-box-binding factor 3	45.500%	Swiss-Prot	moderate database homology
`P42775`	Arabidopsis thaliana	G-box-binding factor 2	40.769%	Swiss-Prot	moderate database homology
`P42774`	Arabidopsis thaliana	G-box-binding factor 1	38.742%	Swiss-Prot	moderate database homology
`Q84LG2`	Arabidopsis thaliana	bZIP transcription factor 68	30.959%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card