LXL04_010760 | RubberDandelionOmics

Gene overview

LXL04_010760

Reference: OH-1004 Chr: Chr02 Coordinates: 152772363-152775347 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2295 bp · LXL04_010760|LXL04_010760|OH1004|cDNA

ATGTCTGAAACTGCATCAGAAGTCCGGTTAGTGCGCTGCCCCAAATGCGAAAATCTGCTCCCTGAGGTTACCGAATATGCAGTTTATCAGTGCGGTGGTTGTTTTGCTGTTCTTCGAGGTAACGTTTCTTCGTTTTCATCATTTCGTTTAATTATTGTTAAGAAGCTCAGATTTGGGTTCGTAAATTCACCAAGCAATAAACATACTGAATCGGGTGTATCTTCCGAGAAATCGGGGGATGAAAGTGAGGGGGTTTCAAA...

CDS

Download CDS FASTA

2295 bp · LXL04_010760|LXL04_010760|OH1004|CDS

ATGTCTGAAACTGCATCAGAAGTCCGGTTAGTGCGCTGCCCCAAATGCGAAAATCTGCTCCCTGAGGTTACCGAATATGCAGTTTATCAGTGCGGTGGTTGTTTTGCTGTTCTTCGAGGTAACGTTTCTTCGTTTTCATCATTTCGTTTAATTATTGTTAAGAAGCTCAGATTTGGGTTCGTAAATTCACCAAGCAATAAACATACTGAATCGGGTGTATCTTCCGAGAAATCGGGGGATGAAAGTGAGGGGGTTTCAAA...

Protein

Download Protein FASTA

764 aa · LXL04_010760|LXL04_010760|OH1004|PROTEIN

MSETASEVRLVRCPKCENLLPEVTEYAVYQCGGCFAVLRGNVSSFSSFRLIIVKKLRFGFVNSPSNKHTESGVSSEKSGDESEGVSNKISKESVNPDFAKRTVKNMSLVSESGVKSNGSSDRRHEIDDGSNINFEEPKPQIPNSRSGSRRSVRTSNWRYRDTNLQEASSSYQYAPRHEYAELVHNANDLEVEDDRDELLRKLDELKDQIVRSRDKSKDKFPINHHLPSYSDPPPYIPHNNHSLLPPSNQVQVFNDPYRSQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010760`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010760

Location Chr02:152772363-152775347 (-)

Description Similar to XLG1: Extra-large guanine nucleotide-binding protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g23460`	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems (By similarity).	Arabidopsis extra-large G proteins (XLGs) regulate root morphogenesis.2008 · DOI: 10.1111/j.1365-313x.2007.03335.x
`At5g05190`	Plays a negative role in salicylic acid (SA)-mediated resistance to powdery mildew (e.g.	ENHANCED DISEASE RESISTANCE4 associates with CLATHRIN HEAVY CHAIN2 and modulates plant immunity by regulating relocation of EDR1 in Arabidopsis.2015 · DOI: 10.1105/tpc.114.134668
`At4g34390`	Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems (By similarity).	Arabidopsis extra-large G proteins (XLGs) regulate root morphogenesis.2008 · DOI: 10.1111/j.1365-313x.2007.03335.x Arabidopsis extra large G-protein 2 (XLG2) interacts with the Gbeta subunit of heterotrimeric G protein and functions in disease resistance.2009 · DOI: 10.1093/mp/ssp001 Ca2+-dependent GTPase, extra-large G protein 2 (XLG2), promotes activation of DNA-binding protein related to vernalization 1 (RTV1), leading to activation of floral integrator genes and early flowering in Arabidopsis.2012 · DOI: 10.1074/jbc.m111.317412

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010760 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006897 endocytosis Biological Process

GO:0006952 defense response Biological Process

GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009620 response to fungus Biological Process

GO:0009863 salicylic acid mediated signaling pathway Biological Process

GO:0030100 regulation of endocytosis Biological Process

GO:0034052 positive regulation of plant-type hypersensitive response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G23460

ath:AT4G34390

ath:AT5G05190

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.444

Rank 1 · LXL04_010760 · OH-1004

Nucleus0.383

Rank 2 · LXL04_010760 · OH-1004

Cytoplasm0.351

Rank 3 · LXL04_010760 · OH-1004

Endoplasmic reticulum0.067

Rank 4 · LXL04_010760 · OH-1004

Plastid0.046

Rank 5 · LXL04_010760 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22910.2EDR4-like_1st7-39 aa

PF11331.14Zn_ribbon_12379-416 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010760	`PF22910.2`	EDR4-like_1st	7	39	3.5e-17	62.4
LXL04_010760	`PF11331.14`	Zn_ribbon_12	379	416	6.3e-12	45.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80462`	Arabidopsis thaliana	Extra-large guanine nucleotide-binding protein 1	36.559%	Swiss-Prot	weak database homology
`Q9FHK4`	Arabidopsis thaliana	Protein ENHANCED DISEASE RESISTANCE 4	33.981%	Swiss-Prot	weak database homology
`C6KIE6`	Arabidopsis thaliana	Extra-large guanine nucleotide-binding protein 2	28.037%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card