Gene Card
Gene overview
cDNA / CDS / Protein Sequences
591 bp · LXL04_010756|LXL04_010756|OH1004|cDNA
ATGGGGAGAGCTAAGAAGGGTCCGAAATTCGCAGTAATGAAGAAGCTAGTCTCTCATAAAGCGATTAAACAACATAAAGAAGACGTTTTGAACCCTAATAAAAAGGATTTAACAAAGCTCCCCAGAAATGTTCCCTATGTTTCTTCTGCTCTGTTCTTTACATATAATACGGCACTTGGACCGCCTTATCGAGTTCTGGTCGATACCAATTTCATCAATTTCTCCATCCAAAACAAATTGGATTTGGAGAAGGGAATGAT...
591 bp · LXL04_010756|LXL04_010756|OH1004|CDS
ATGGGGAGAGCTAAGAAGGGTCCGAAATTCGCAGTAATGAAGAAGCTAGTCTCTCATAAAGCGATTAAACAACATAAAGAAGACGTTTTGAACCCTAATAAAAAGGATTTAACAAAGCTCCCCAGAAATGTTCCCTATGTTTCTTCTGCTCTGTTCTTTACATATAATACGGCACTTGGACCGCCTTATCGAGTTCTGGTCGATACCAATTTCATCAATTTCTCCATCCAAAACAAATTGGATTTGGAGAAGGGAATGAT...
Protein
Download Protein FASTA196 aa · LXL04_010756|LXL04_010756|OH1004|PROTEIN
MGRAKKGPKFAVMKKLVSHKAIKQHKEDVLNPNKKDLTKLPRNVPYVSSALFFTYNTALGPPYRVLVDTNFINFSIQNKLDLEKGMMDCLYAKCTPCITDCVMAELEKLGQKYRVALRIAKDPRFERLPCTHKGTYADDCIVERVTQHKCYLVATCDRDLKRRIRKIPGVPIMYITQHKYSIERLPEATMGGAPRM
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_010756 |
|---|---|
| TK1151 ID | TkA03G547380 |
| OH-1004 ID | LXL04_010756 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_010756 |
|---|---|
| Location | Chr02:152718960-152720302 (-) |
| Description | Similar to FCF1: rRNA-processing protein FCF1 homolog |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0006364 rRNA processing Biological Process GO:0030490 maturation of SSU-rRNA Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0032040 small-subunit processome Cellular Component GO:0003723 RNA binding Molecular Function GO:0004521 RNA endonuclease activity Molecular Function |
| KEGG gene cross-reference | bta:508270 hsa:51077 mmu:73736 pon:100171429 sce:YDR339C These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF18477.8PIN_965-177 aaPF04900.19Fcf188-184 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_010756 | PF18477.8 | PIN_9 | 65 | 177 | 6e-07 | 30.4 |
| LXL04_010756 | PF04900.19 | Fcf1 | 88 | 184 | 6e-37 | 126.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.