LXL04_010744 | RubberDandelionOmics

Gene overview

LXL04_010744

Reference: OH-1004 Chr: Chr02 Coordinates: 152486389-152487501 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

726 bp · LXL04_010744|LXL04_010744|OH1004|cDNA

ATGTCCACCACCATCCCTTTCCCACCACCACCGCCGCAGCAACTTTCCAGCGTGACGCATTACTACATAACCAACCTTGGCCTCGGTTACGCTATCGCCATCGCTTTCGGATTCCTTGTCCTCTTCTCCTCACTTCTTCTAGCTTCATACATCTGTTTCCGTCACCGTCATACTCACCGCCACCAATTTCGAAACCCTAACGGCGGTGGCTCTGATAACGGCGTGTTCGTTCCCAGCATAATTTTCGTCGACGAAGAGAT...

CDS

Download CDS FASTA

726 bp · LXL04_010744|LXL04_010744|OH1004|CDS

ATGTCCACCACCATCCCTTTCCCACCACCACCGCCGCAGCAACTTTCCAGCGTGACGCATTACTACATAACCAACCTTGGCCTCGGTTACGCTATCGCCATCGCTTTCGGATTCCTTGTCCTCTTCTCCTCACTTCTTCTAGCTTCATACATCTGTTTCCGTCACCGTCATACTCACCGCCACCAATTTCGAAACCCTAACGGCGGTGGCTCTGATAACGGCGTGTTCGTTCCCAGCATAATTTTCGTCGACGAAGAGAT...

Protein

Download Protein FASTA

241 aa · LXL04_010744|LXL04_010744|OH1004|PROTEIN

MSTTIPFPPPPPQQLSSVTHYYITNLGLGYAIAIAFGFLVLFSSLLLASYICFRHRHTHRHQFRNPNGGGSDNGVFVPSIIFVDEEINEDLNVVVGLDQSVINSYPKFPFSKVIPKGIDSLCAICLCEYREAEMMRMLPDCKHCFHLTCVDAWLKLNASCPVCRSSPLPTPLSTPLAEVTSDQMKLILEEQQSSWFTHSLRSNSSIFVYTSQAFLHLLWLSNLALCEDLRSEAYTEGKFSD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010744`
TK1151 ID	TkA03G546020
OH-1004 ID	LXL04_010744
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	64.600
Protein coverage (%)	TK1151 90.370 / OH-1004 74.274 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010744

Location Chr02:152486389-152487501 (+)

Description Similar to ATL67: RING-H2 finger protein ATL67

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46160`	RING-H2 finger protein ATL67.	No verified direct reference in this release
`At3g61550`	RING-H2 finger protein ATL68.	No verified direct reference in this release
`At5g07040`	Putative RING-H2 finger protein ATL69.	No verified direct reference in this release
`At2g35910`	RING-H2 finger protein ATL70.	No verified direct reference in this release
`At5g06490`	Putative RING-H2 finger protein ATL71.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010744 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT2G35910

ath:AT2G46160

ath:AT3G61550

ath:AT5G06490

ath:AT5G07040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.245

Rank 1 · LXL04_010744 · OH-1004

Cell membrane0.240

Rank 2 · LXL04_010744 · OH-1004

Endoplasmic reticulum0.223

Rank 3 · LXL04_010744 · OH-1004

Nucleus0.218

Rank 4 · LXL04_010744 · OH-1004

Lysosome / Vacuole0.212

Rank 5 · LXL04_010744 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13639.13zf-RING_2121-164 aa

PF17123.12zf-RING_11122-150 aa

PF12678.14zf-rbx1126-164 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010744	`PF13639.13`	zf-RING_2	121	164	5.3e-12	46.5
LXL04_010744	`PF17123.12`	zf-RING_11	122	150	1.6e-07	31.6
LXL04_010744	`PF12678.14`	zf-rbx1	126	164	5.9e-08	33.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82353`	Arabidopsis thaliana	RING-H2 finger protein ATL67	57.865%	Swiss-Prot	moderate database homology
`Q9M313`	Arabidopsis thaliana	RING-H2 finger protein ATL68	56.354%	Swiss-Prot	moderate database homology
`Q9FL42`	Arabidopsis thaliana	Putative RING-H2 finger protein ATL69	42.138%	Swiss-Prot	moderate database homology
`Q8RX29`	Arabidopsis thaliana	RING-H2 finger protein ATL70	40.571%	Swiss-Prot	moderate database homology
`Q9FG21`	Arabidopsis thaliana	Putative RING-H2 finger protein ATL71	37.714%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card