LXL04_010682 | RubberDandelionOmics

Gene overview

LXL04_010682

Reference: OH-1004 Chr: Chr02 Coordinates: 151506871-151509645 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1224 bp · LXL04_010682|LXL04_010682|OH1004|cDNA

ATGGAGACCGAGGAAGAAGCATCTGGACAGATGACGGACGAGATCTACACCAACGGCGGCGAAGATGAACCGTTGCAGCAGCAGCAGCAACGGAGACCGATTATCAGTGGCGAGCAACTCGACATCGAGGCGTACGCCGCCTTATACACAGGTCGTACTAAAATTTCGCGGTTGATATTCATCGCCGACAAATGTGGTAATGTTTCGATGCAGTTAGAGGCGCTTCGAATGGCGTATGATGAGATTAAGAAGGGAGAGAA...

CDS

Download CDS FASTA

1224 bp · LXL04_010682|LXL04_010682|OH1004|CDS

ATGGAGACCGAGGAAGAAGCATCTGGACAGATGACGGACGAGATCTACACCAACGGCGGCGAAGATGAACCGTTGCAGCAGCAGCAGCAACGGAGACCGATTATCAGTGGCGAGCAACTCGACATCGAGGCGTACGCCGCCTTATACACAGGTCGTACTAAAATTTCGCGGTTGATATTCATCGCCGACAAATGTGGTAATGTTTCGATGCAGTTAGAGGCGCTTCGAATGGCGTATGATGAGATTAAGAAGGGAGAGAA...

Protein

Download Protein FASTA

407 aa · LXL04_010682|LXL04_010682|OH1004|PROTEIN

METEEEASGQMTDEIYTNGGEDEPLQQQQQRRPIISGEQLDIEAYAALYTGRTKISRLIFIADKCGNVSMQLEALRMAYDEIKKGENTQLFREVVHKIDGRLGPNYSADSSWMDAVDRRADQRKEKLENELNAYRTNLIKESIRMGYNDFGDFYYSHGALGDAFKNYVRTRDYCTTAKHIIHMCLNAILVSIEMGQFAHVTSYVSKAEQNKNDLDPITIAKLQCAAGLAHLEAKKYKHAARKAKVIDNINFRNFLELVPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010682`
TK1151 ID	TkA03G543180
OH-1004 ID	LXL04_010682
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010682

Location Chr02:151506871-151509645 (+)

Description Similar to CSN1: COP9 signalosome complex subunit 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g61140`	Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes such as photomorphogenesis and auxin and jasmonate responses.	The COP9 complex, a novel multisubunit nuclear regulator involved in light control of a plant developmental switch.1996 · DOI: 10.1016/s0092-8674(00)80082-3

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010682 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000338 protein deneddylation Biological Process

GO:0006972 hyperosmotic response Biological Process

GO:0007254 JNK cascade Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0045116 protein neddylation Biological Process

GO:0065003 protein-containing complex assembly Biological Process

GO:2000434 regulation of protein neddylation Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G61140

ddi:DDB_G0283587

hsa:2873

xla:431842

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.540

Rank 1 · LXL04_010682 · OH-1004

Nucleus0.512

Rank 2 · LXL04_010682 · OH-1004

Lysosome / Vacuole0.069

Rank 3 · LXL04_010682 · OH-1004

Cell membrane0.063

Rank 4 · LXL04_010682 · OH-1004

Golgi apparatus0.045

Rank 5 · LXL04_010682 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10602.16RPN7109-242 aa

PF01399.34PCI283-362 aa

PF21151.3CSN1_C366-392 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010682	`PF10602.16`	RPN7	109	242	1.8e-38	132.6
LXL04_010682	`PF01399.34`	PCI	283	362	2.3e-16	60.5
LXL04_010682	`PF21151.3`	CSN1_C	366	392	9e-09	35.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P45432`	Arabidopsis thaliana	COP9 signalosome complex subunit 1	69.575%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card