LXL04_010679 | RubberDandelionOmics

Gene overview

LXL04_010679

Reference: OH-1004 Chr: Chr02 Coordinates: 151451332-151455396 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2661 bp · LXL04_010679|LXL04_010679|OH1004|cDNA

ATGGATAAAAATGCTTCACGGACACCATCACAACAACCACCGCCTGTAAACCAAAAGCTACGTCGTTTCAATGTGTGCGAGGATGAACCACCGCCTTCCTCCGCACCTGCTACAGCGTCAACATCATCGTCACAAACTTCAAGTGCAAAAAATGAGTCGGAATCGCAAAAAACTACCCCCACTCTTTCCAGATGTGTCGAATTATACCGTTGTCAAAAAGGCTCGAATGATCCATCTCCCTCGCTAGTCGATTCACCCGA...

CDS

Download CDS FASTA

2661 bp · LXL04_010679|LXL04_010679|OH1004|CDS

ATGGATAAAAATGCTTCACGGACACCATCACAACAACCACCGCCTGTAAACCAAAAGCTACGTCGTTTCAATGTGTGCGAGGATGAACCACCGCCTTCCTCCGCACCTGCTACAGCGTCAACATCATCGTCACAAACTTCAAGTGCAAAAAATGAGTCGGAATCGCAAAAAACTACCCCCACTCTTTCCAGATGTGTCGAATTATACCGTTGTCAAAAAGGCTCGAATGATCCATCTCCCTCGCTAGTCGATTCACCCGA...

Protein

Download Protein FASTA

886 aa · LXL04_010679|LXL04_010679|OH1004|PROTEIN

MDKNASRTPSQQPPPVNQKLRRFNVCEDEPPPSSAPATASTSSSQTSSAKNESESQKTTPTLSRCVELYRCQKGSNDPSPSLVDSPDTQLRSIDEKPSKGLLLHGNLTIWVYEAKELPSMDMFNSSDPYVTIAIANAVVGKTYVIKNTENPTWNQRFDVHVAHHASEVHFLVKDSDAVGSQLIGVVAIPVKDISSGSKFEGIFPLINTNGKPFKATLKLAMQYIRIEKLSSYNNGVGAGPEYTGVPGTYFPLRKGGKVTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010679`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010679

Location Chr02:151451332-151455396 (+)

Description Similar to PLDBETA1: Phospholipase D beta 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g42010`	Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond to generate phosphatidic acids (PA).	No verified direct reference in this release
`At4g00240`	Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond to generate phosphatidic acids (PA).	No verified direct reference in this release
`At4g11850`	Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond to generate phosphatidic acids (PA).	Expression and characterization of Arabidopsis phospholipase Dgamma2.2006 · DOI: 10.1016/j.bbalip.2006.09.017
`At4g11840`	Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond to generate phosphatidic acids (PA).	No verified direct reference in this release
`At4g11830`	Hydrolyzes glycerol-phospholipids at the terminal phosphodiesteric bond to generate phosphatidic acids (PA).	Expression and characterization of Arabidopsis phospholipase Dgamma2.2006 · DOI: 10.1016/j.bbalip.2006.09.017

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010679 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006643 membrane lipid metabolic process Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009395 phospholipid catabolic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010044 response to aluminum ion Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0046470 phosphatidylcholine metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G42010

ath:AT4G00240

ath:AT4G11830

ath:AT4G11840

ath:AT4G11850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.478

Rank 1 · LXL04_010679 · OH-1004

Cell membrane0.299

Rank 2 · LXL04_010679 · OH-1004

Nucleus0.218

Rank 3 · LXL04_010679 · OH-1004

Lysosome / Vacuole0.127

Rank 4 · LXL04_010679 · OH-1004

Golgi apparatus0.117

Rank 5 · LXL04_010679 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168.37C2105-205 aa

PF00614.30PLDc294-875 aa

PF13091.13PLDc_2734-770 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010679	`PF00168.37`	C2	105	205	5.8e-22	78.6
LXL04_010679	`PF00614.30`	PLDc	294	875	2.2e-224	746.7
LXL04_010679	`PF13091.13`	PLDc_2	734	770	7.4e-10	39.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P93733`	Arabidopsis thaliana	Phospholipase D beta 1	65.746%	Swiss-Prot	strong database homology
`O23078`	Arabidopsis thaliana	Phospholipase D beta 2	66.947%	Swiss-Prot	strong database homology
`Q9T053`	Arabidopsis thaliana	Phospholipase D gamma 1	62.454%	Swiss-Prot	strong database homology
`Q9T052`	Arabidopsis thaliana	Phospholipase D gamma 3	61.864%	Swiss-Prot	strong database homology
`Q9T051`	Arabidopsis thaliana	Phospholipase D gamma 2	61.715%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card