LXL04_010666 | RubberDandelionOmics

Gene overview

LXL04_010666

Reference: OH-1004 Chr: Chr02 Coordinates: 151143083-151144781 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

876 bp · LXL04_010666|LXL04_010666|OH1004|cDNA

ATGTTGAAACATCTAAAATCTCTCAAACTTTTAGATTGTTTGTATCTTGAAGAGTTACCAGAGAATCTCGGATGGTTAGGAAATTTGAAGAAGCTGAGACTGTCATCTACAGGTATTAGACGTCTTCCGGATAGCATTCGCATGCTGATTCATCTGAAATCTCTACGACTTGAATCTTGTGGGCTCCTTCAGAAGTTACCAGAGGATATTGGGCAGTTAGAATGTTTAGAGAAGCTGAAACTGGCAAAGTGTGAATCTTT...

CDS

Download CDS FASTA

876 bp · LXL04_010666|LXL04_010666|OH1004|CDS

ATGTTGAAACATCTAAAATCTCTCAAACTTTTAGATTGTTTGTATCTTGAAGAGTTACCAGAGAATCTCGGATGGTTAGGAAATTTGAAGAAGCTGAGACTGTCATCTACAGGTATTAGACGTCTTCCGGATAGCATTCGCATGCTGATTCATCTGAAATCTCTACGACTTGAATCTTGTGGGCTCCTTCAGAAGTTACCAGAGGATATTGGGCAGTTAGAATGTTTAGAGAAGCTGAAACTGGCAAAGTGTGAATCTTT...

Protein

Download Protein FASTA

291 aa · LXL04_010666|LXL04_010666|OH1004|PROTEIN

MLKHLKSLKLLDCLYLEELPENLGWLGNLKKLRLSSTGIRRLPDSIRMLIHLKSLRLESCGLLQKLPEDIGQLECLEKLKLAKCESLEDIPNSISNMKCLRYFDLRFCRRVEKLPEELGNLECLKELDIAFTGISRLPHNISSLNGLLKLVLGGSVKTAMAPPAVTTTLVTPKSNPPILRNPRTTGDCGLVVPISDLDLKPQGQLTLTIVKRNNLKNMEMIGKSDPYVTAYIPPLENFKIKVVDNNFSWAGVGAGVELVG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010666`
TK1151 ID	TkA03G542290
OH-1004 ID	LXL04_010666
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 45.361 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010666

Location Chr02:151143083-151144781 (+)

Description Similar to RUN1: Disease resistance protein RUN1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g13920`	Receptor-like protein 50.	No verified direct reference in this release
`At3g61050`	May be involved in membrane trafficking (By similarity).	No verified direct reference in this release
`At5g44510`	TIR-NB-LRR receptor-like protein that contributes to disease resistance induced by the Pseudomonas syringae type III effector AvrB.	Arabidopsis TAO1 is a TIR-NB-LRR protein that contributes to disease resistance induced by the Pseudomonas syringae effector AvrB.2008 · DOI: 10.1073/pnas.0802157105

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010666 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0019677 NAD+ catabolic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003953 NAD+ nucleosidase activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0043531 ADP binding Molecular Function

GO:0050135 NADP+ nucleosidase activity Molecular Function

GO:0061809 NAD+ nucleosidase activity, cyclic ADP-ribose generating Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.390

Rank 1 · LXL04_010666 · OH-1004

Cytoplasm0.317

Rank 2 · LXL04_010666 · OH-1004

Cell membrane0.165

Rank 3 · LXL04_010666 · OH-1004

Endoplasmic reticulum0.118

Rank 4 · LXL04_010666 · OH-1004

Mitochondrion0.093

Rank 5 · LXL04_010666 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_142-107 aa

PF25019.1LRR_R13L1-DRL2128-84 aa

PF23598.2LRR_1479-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010666	`PF23598.2`	LRR_14	2	107	1.2e-23	84.2
LXL04_010666	`PF25019.1`	LRR_R13L1-DRL21	28	84	4.5e-11	43.5
LXL04_010666	`PF23598.2`	LRR_14	79	157	1.2e-23	84.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YT3`	Arabidopsis thaliana	Receptor-like protein 50	36.538%	Swiss-Prot	moderate database homology
`Q9LEX1`	Arabidopsis thaliana	Calcium-dependent lipid-binding protein	56.667%	Swiss-Prot	weak database homology
`Q9FI14`	Arabidopsis thaliana	Disease resistance protein TAO1	35.404%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card