LXL04_010639 | RubberDandelionOmics

Gene overview

LXL04_010639

Reference: OH-1004 Chr: Chr02 Coordinates: 150310268-150326435 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5418 bp · LXL04_010639|LXL04_010639|OH1004|cDNA

ATGGGGTCTTCTTCAACTTCATCCAATTCCAATCAAAAGAGCTTTAAGTATCATGTGTTCTTAAGCTTTAGAGGAGAAGACACACGTAAGACCTTTGTTGATCATCTTTATGCTTCTCTTAAGCAAAGAGAATCTCTCCCAAGAACATCGAGAAAACATTTAATGGcgtcttcttcatcttcatccaATCAAAAGAGCTTTAAGTATCATGTGTTCTTGAGCTTTAGAGGAGAAGACACTCGTAAGACCTTTGTTGATCA...

CDS

Download CDS FASTA

5418 bp · LXL04_010639|LXL04_010639|OH1004|CDS

ATGGGGTCTTCTTCAACTTCATCCAATTCCAATCAAAAGAGCTTTAAGTATCATGTGTTCTTAAGCTTTAGAGGAGAAGACACACGTAAGACCTTTGTTGATCATCTTTATGCTTCTCTTAAGCAAAGAGAATCTCTCCCAAGAACATCGAGAAAACATTTAATGGCGTCTTCTTCATCTTCATCCAATCAAAAGAGCTTTAAGTATCATGTGTTCTTGAGCTTTAGAGGAGAAGACACTCGTAAGACCTTTGTTGATCA...

Protein

Download Protein FASTA

1805 aa · LXL04_010639|LXL04_010639|OH1004|PROTEIN

MGSSSTSSNSNQKSFKYHVFLSFRGEDTRKTFVDHLYASLKQRESLPRTSRKHLMASSSSSSNQKSFKYHVFLSFRGEDTRKTFVDHLYTSLTRVGIHTFRDNEELEKGKQIDQLFEAIEESRFFIIVFSKNYASSSWCLKEVTKIMECQDGNQQIAYPVFYDVEPTDIRRQSGPVGIAIAKHKSNEQIRKWEKALKDAGNLVGWDLKNVANGHEAESIKKIVEKVSLKLRSIHLSNDENVIGMDRRMRELELSLGIGLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010639`
TK1151 ID	TkA03G542170
OH-1004 ID	LXL04_010639
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	77.200
Protein coverage (%)	TK1151 100.000 / OH-1004 15.291 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010639

Location Chr02:150310268-150326435 (+)

Description Similar to RUN1: Disease resistance protein RUN1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12010`	TIR-NB-LRR receptor-like protein involved in plant defense.	Matching NLR Immune Receptors to Autoimmunity in camta3 Mutants Using Antimorphic NLR Alleles.2017 · DOI: 10.1016/j.chom.2017.03.005

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010639 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0019677 NAD+ catabolic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003953 NAD+ nucleosidase activity Molecular Function

GO:0043531 ADP binding Molecular Function

GO:0050135 NADP+ nucleosidase activity Molecular Function

GO:0061809 NAD+ nucleosidase activity, cyclic ADP-ribose generating Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.486

Rank 1 · LXL04_010639 · OH-1004

Cell membrane0.306

Rank 2 · LXL04_010639 · OH-1004

Nucleus0.236

Rank 3 · LXL04_010639 · OH-1004

Endoplasmic reticulum0.077

Rank 4 · LXL04_010639 · OH-1004

Extracellular0.064

Rank 5 · LXL04_010639 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01582.26TIR16-43 aa

PF01582.26TIR68-237 aa

PF13676.12TIR_271-166 aa

PF00931.29NB-ARC261-416 aa

PF05729.19NACHT265-392 aa

PF23282.2WHD_ROQ1484-552 aa

PF23598.2LRR_14818-904 aa

PF23598.2LRR_14900-972 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010639	`PF01582.26`	TIR	16	43	4.2e-84	281.5
LXL04_010639	`PF01582.26`	TIR	68	237	4.2e-84	281.5
LXL04_010639	`PF13676.12`	TIR_2	71	166	5.2e-29	101.9
LXL04_010639	`PF00931.29`	NB-ARC	261	416	2.8e-48	164.5
LXL04_010639	`PF05729.19`	NACHT	265	392	4.3e-16	59.9
LXL04_010639	`PF23282.2`	WHD_ROQ1	484	552	4.4e-18	65.9
LXL04_010639	`PF23598.2`	LRR_14	818	904	1.1e-49	169.9
LXL04_010639	`PF23598.2`	LRR_14	900	972	1.1e-49	169.9
LXL04_010639	`PF23598.2`	LRR_14	960	1012	1.1e-49	169.9
LXL04_010639	`PF01582.26`	TIR	1003	1161	4.2e-84	281.5
LXL04_010639	`PF13676.12`	TIR_2	1013	1084	5.2e-29	101.9
LXL04_010639	`PF00931.29`	NB-ARC	1170	1338	2.8e-48	164.5
LXL04_010639	`PF05729.19`	NACHT	1188	1335	4.3e-16	59.9
LXL04_010639	`PF23598.2`	LRR_14	1594	1692	1.1e-49	169.9
LXL04_010639	`PF23598.2`	LRR_14	1697	1787	1.1e-49	169.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZ66`	Arabidopsis thaliana	Disease resistance-like protein DSC1	31.622%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card