LXL04_010611 | RubberDandelionOmics

Gene overview

LXL04_010611

Reference: OH-1004 Chr: Chr02 Coordinates: 149631960-149637505 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2661 bp · LXL04_010611|LXL04_010611|OH1004|cDNA

atgtcacttacaattgacgtatctaccgccaggatggtagccaaccatcgtaagtggggattgtcagtcccatatagtggtcttactcataagaaattttccgtacttatgaaatggagaaatgtctcacataaccttgcaaattacctagggtttaataagcctagtgatcatggtcaactccgtgatggtgagacccaaacaagggctagtcacagaatctctcacgatcctaaggattaccttgctctaggagtaag...

CDS

Download CDS FASTA

2661 bp · LXL04_010611|LXL04_010611|OH1004|CDS

ATGTCACTTACAATTGACGTATCTACCGCCAGGATGGTAGCCAACCATCGTAAGTGGGGATTGTCAGTCCCATATAGTGGTCTTACTCATAAGAAATTTTCCGTACTTATGAAATGGAGAAATGTCTCACATAACCTTGCAAATTACCTAGGGTTTAATAAGCCTAGTGATCATGGTCAACTCCGTGATGGTGAGACCCAAACAAGGGCTAGTCACAGAATCTCTCACGATCCTAAGGATTACCTTGCTCTAGGAGTAAG...

Protein

Download Protein FASTA

886 aa · LXL04_010611|LXL04_010611|OH1004|PROTEIN

MSLTIDVSTARMVANHRKWGLSVPYSGLTHKKFSVLMKWRNVSHNLANYLGFNKPSDHGQLRDGETQTRASHRISHDPKDYLALGVSNCGVFTSVEQHPSLSFYKTLGHVTCTELVADWAFDLIKAEKLAFLLSKSKSRSNRSGPCPGTSNEIGGRFPAVAAGARLRAREPTQQTRKGCLSGHLRMIRAWWAYPSQPGVCWDSRRAAPYDVHDQSDPDVPVGTRGDRYDRYCIRIEEMRQSVRIIVQCPNQMPSGMIKAD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010611`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010611

Location Chr02:149631960-149637505 (+)

Description Similar to Probable cytochrome c biosynthesis protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q9T6H8`	Forms a complex with CCMFC, CCMFN2 and CCMH that performs the assembly of heme with c-type apocytochromes in mitochondria.	No verified direct reference in this release
`AtMg00960`	Forms a complex with CCMFC, CCMFN1 and CCMH that performs the assembly of heme with c-type apocytochromes in mitochondria.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010611 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0017004 cytochrome complex assembly Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0032991 protein-containing complex Cellular Component

GO:0015232 heme transmembrane transporter activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0020037 heme binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.438

Rank 1 · LXL04_010611 · OH-1004

Cytoplasm0.405

Rank 2 · LXL04_010611 · OH-1004

Mitochondrion0.139

Rank 3 · LXL04_010611 · OH-1004

Cell membrane0.106

Rank 4 · LXL04_010611 · OH-1004

Endoplasmic reticulum0.055

Rank 5 · LXL04_010611 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00346.25Complex1_49kDa198-281 aa

PF00346.25Complex1_49kDa469-556 aa

PF01578.27Cytochrom_C_asm597-807 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010611	`PF00346.25`	Complex1_49kDa	198	281	3.2e-52	178.0
LXL04_010611	`PF00346.25`	Complex1_49kDa	469	556	3.2e-52	178.0
LXL04_010611	`PF01578.27`	Cytochrom_C_asm	597	807	7.1e-06	26.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T6H8`	Arabidopsis thaliana	Cytochrome c biogenesis CcmF N-terminal-like mitochondrial protein 1	86.486%	Swiss-Prot	weak database homology
`Q33884`	Arabidopsis thaliana	Cytochrome c biogenesis CcmF N-terminal-like mitochondrial protein 2 (Fragment)	68.205%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card