LXL04_010571 | RubberDandelionOmics

Gene overview

LXL04_010571

Reference: OH-1004 Chr: Chr02 Coordinates: 149235844-149237270 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

903 bp · LXL04_010571|LXL04_010571|OH1004|cDNA

ATGTACAGAGATCGAGGTGGATCGTCGGCGATGGttggaggaggaggtggtggaCCGTTGGATCGGAAACAAATCAATGATGCGTTAGACAAGCACTTAGAAAAGACGTCATCTTCGACCTCCAGGGTTTTGAATAGTAATAGCAAGGAGAAAGAAAAATTGTCTATGCCTTCGACTTCTGCAGCTGGTGGCGGTGGCAAATCTCATCACATGGACCACCATCGCGACAACCGTTCCTCCTCTACTATACCCAACCCCAA...

CDS

Download CDS FASTA

903 bp · LXL04_010571|LXL04_010571|OH1004|CDS

ATGTACAGAGATCGAGGTGGATCGTCGGCGATGGTTGGAGGAGGAGGTGGTGGACCGTTGGATCGGAAACAAATCAATGATGCGTTAGACAAGCACTTAGAAAAGACGTCATCTTCGACCTCCAGGGTTTTGAATAGTAATAGCAAGGAGAAAGAAAAATTGTCTATGCCTTCGACTTCTGCAGCTGGTGGCGGTGGCAAATCTCATCACATGGACCACCATCGCGACAACCGTTCCTCCTCTACTATACCCAACCCCAA...

Protein

Download Protein FASTA

300 aa · LXL04_010571|LXL04_010571|OH1004|PROTEIN

MYRDRGGSSAMVGGGGGGPLDRKQINDALDKHLEKTSSSTSRVLNSNSKEKEKLSMPSTSAAGGGGKSHHMDHHRDNRSSSTIPNPKNKASDDESETDSEESDVSGSDEDDTSWISWFCNLRGNEFFCEVDDDYIQDDFNLCGLSSQVPYFDYALDLILDAESSHGDMFTEEQNELVESAAEMLYGLIHVRYILTTRGMSAMLEKYKNYDFGRCPRVYCCGQPCLPVGQSDIPRSSTVKIYCPKCEDIYYPRSKYQGNID...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010571`
TK1151 ID	TkA03G535870
OH-1004 ID	LXL04_010571
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010571

Location Chr02:149235844-149237270 (+)

Description Similar to CKB1: Casein kinase II subunit beta-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47080`	Plays a complex role in regulating the basal catalytic activity of the alpha subunit.	Reconstitution of Arabidopsis casein kinase II from recombinant subunits and phosphorylation of transcription factor GBF1.1995 · DOI: 10.1105/tpc.7.1.105
`At2g44680`	Plays a complex role in regulating the basal catalytic activity of the alpha subunit.	No verified direct reference in this release
`At4g17640`	Plays a complex role in regulating the basal catalytic activity of the alpha subunit.	No verified direct reference in this release
`At3g60250`	Plays a complex role in regulating the basal catalytic activity of the alpha subunit.	Protein kinase CK2 interacts with and phosphorylates the Arabidopsis circadian clock-associated 1 protein.1998 · DOI: 10.1073/pnas.95.18.11020

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010571 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0010017 red or far-red light signaling pathway Biological Process

GO:0016055 Wnt signaling pathway Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

GO:0042753 positive regulation of circadian rhythm Biological Process

GO:0048573 photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005956 protein kinase CK2 complex Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G44680

ath:AT3G60250

ath:AT4G17640

ath:AT5G47080

xla:108698568

xla:399320

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.786

Rank 1 · LXL04_010571 · OH-1004

Cytoplasm0.274

Rank 2 · LXL04_010571 · OH-1004

Cell membrane0.041

Rank 3 · LXL04_010571 · OH-1004

Endoplasmic reticulum0.028

Rank 4 · LXL04_010571 · OH-1004

Mitochondrion0.022

Rank 5 · LXL04_010571 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01214.24CK_II_beta113-296 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010571	`PF01214.24`	CK_II_beta	113	296	1.4e-76	257.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P40228`	Arabidopsis thaliana	Casein kinase II subunit beta-1	73.000%	Swiss-Prot	strong database homology
`O80507`	Arabidopsis thaliana	Putative casein kinase II subunit beta-4	75.177%	Swiss-Prot	strong database homology
`P40229`	Arabidopsis thaliana	Casein kinase II subunit beta-2	70.861%	Swiss-Prot	strong database homology
`O81275`	Arabidopsis thaliana	Casein kinase II subunit beta-3	70.423%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card